Recombinant Alkalilimnicola ehrlichei Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Alkalilimnicola ehrlichei Protease HtpX is a heat shock-inducible enzyme involved in proteolytic regulation. It belongs to the M48 family of zinc metalloproteases and is localized to the cytoplasmic membrane . Its recombinant form allows controlled studies of substrate specificity, catalytic mechanisms, and biotechnological applications.

Key Features:

  • UniProt ID: Q0AAR8

  • Gene Name: htpX (Ordered Locus: mLg_0715)

  • Protein Length: 301 amino acids (residues 1–301)

  • Catalytic Activity: Zinc-dependent endoprotease (EC 3.4.24.-)

Sequence Highlights:

  • N-terminal signal peptide for membrane localization .

  • Conserved zinc-binding motifs typical of M48 metalloproteases .

  • Structural domains optimized for degrading misfolded membrane proteins .

Functional Insights from Homologs:

  • Role in Protein Quality Control:

    • In E. coli, HtpX collaborates with FtsH to degrade misfolded membrane proteins .

    • Exhibits proteolytic activity against casein and SecY (a membrane translocase) .

  • Antibiotic Resistance:

    • In Stenotrophomonas maltophilia, HtpX contributes to intrinsic aminoglycoside resistance by mitigating antibiotic-induced protein stress .

Potential Applications:

  1. Biotechnological Tool:

    • Study membrane protein degradation mechanisms .

    • Engineer thermostable proteases for industrial processes .

  2. Antibiotic Adjuvant Development:

    • Targeting HtpX could enhance aminoglycoside efficacy against resistant pathogens .

Limitations and Future Directions

Current data on A. ehrlichei HtpX remain limited compared to its homologs. Further studies are needed to:

  • Resolve its crystal structure to clarify substrate-binding pockets .

  • Validate its interaction with chaperones like ClpA in antibiotic resistance pathways .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; Mlg_0715; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Target Names
htpX
Target Protein Sequence
MKRIGLFLLTNLAILVVLGVVLFILQAVFGVRTLDEAGVGLDYTGLLIIAAVIGFGGSFI SLAMSKFIAKRMTGARVIEKPRSEAEQWLVDTVRRFARQEGIGMPEVAIYDAPDMNAFAT GARRNNSLVAVSTGLLQSMTRDEAEAVIGHEIAHISNGDMVTLTLIQGVVNTFVVFFSRI IGHFVDRVVFKTEQGHGPAYFITSIFAQIVLGILASVIVMWFSRQREYRADAGGAKLAGR DKMIAALERLKRSVDQEHLPDQLEAFGINGNRGGGMKEWFMSHPPLDDRIAALKEGRHLR G
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its fundamental role in bacterial systems?

HtpX is a membrane-bound zinc metalloprotease that plays a critical role in proteolytic quality control of membrane proteins. It functions in conjunction with FtsH, another membrane-bound ATP-dependent protease, to prevent the accumulation of misfolded proteins in the bacterial membrane . Studies have confirmed that HtpX exhibits proteolytic activities against both membrane and soluble proteins, demonstrating its versatile function in protein degradation pathways . Specifically in Escherichia coli, HtpX has been confirmed as a zinc-dependent endoprotease that forms part of the membrane-localized proteolytic system, indicating its conservation across bacterial species with potentially similar functions in Alkalilimnicola ehrlichei .

What structural characteristics define HtpX proteases?

HtpX proteases are integral membrane proteins containing multiple hydrophobic regions that likely function as transmembrane segments. The E. coli HtpX, for instance, possesses four hydrophobic regions (H1-H4), although there remains debate about whether the two C-terminal regions are actually embedded in the membrane . The protein belongs to the M48 family of zinc metalloproteinases and contains the characteristic M48 peptidase domain essential for its catalytic function . The active site typically includes zinc-binding motifs that are critical for its proteolytic activity, as demonstrated by the fact that when supplemented with Zn²⁺, purified HtpX exhibits self-cleavage activity and can degrade substrates including casein and membrane proteins like SecY .

How should researchers approach the purification of recombinant HtpX?

Purification of HtpX presents unique challenges due to its membrane-bound nature and tendency for self-degradation. A successful approach involves:

  • Expression in E. coli BL21(DE3) cells using a pET-derived vector with a C-terminal His-tag (His₈-tag)

  • Extraction from membranes using appropriate detergents, with octyl-β-d-glucoside proving effective for maintaining protein stability

  • Implementation of a three-step purification protocol:

    • Cobalt-affinity chromatography

    • Anion-exchange chromatography

    • Size-exclusion chromatography

This methodological approach has successfully yielded milligram quantities of pure, well-folded protein suitable for structural and functional studies . When working specifically with Alkalilimnicola ehrlichei HtpX, researchers should consider that purification may require modification of these protocols to account for species-specific properties of the protein.

What expression systems are suitable for recombinant HtpX production?

Multiple expression systems have been evaluated for HtpX production, with varying efficacy:

Expression SystemAdvantagesConsiderationsReference
E. coli BL21(DE3)High yields, well-established protocolsRequires optimization of induction conditions
Bacillus subtilis WB800NEffective for some HtpX variants (e.g., from P. megaterium)Requires electro-transformation
Yeast systemsPotential for proper eukaryotic post-translational modificationsMay have lower yields than bacterial systems
Baculovirus systemsSuited for complex proteins requiring specific foldingMore technically demanding than bacterial systems
Mammalian cell systemsHighest fidelity to native eukaryotic processingMost costly and complex setup

For Alkalilimnicola ehrlichei HtpX specifically, multiple expression systems have been developed, including yeast, E. coli, baculovirus, and mammalian cell systems, suggesting flexibility in recombinant production approaches .

How can researchers effectively measure the in vivo proteolytic activity of HtpX?

Measuring the proteolytic activity of HtpX in vivo has been challenging due to limited knowledge of physiological substrates. Recent methodological advances have addressed this issue through:

  • Development of model substrates specifically designed for HtpX (e.g., XMS1 - HtpX Model Substrate 1)

  • Establishment of semiquantitative and convenient in vivo protease activity assay systems

  • Detection methods that allow differential analysis of protease activities among HtpX mutants carrying mutations in conserved regions

This approach enables researchers to:

  • Quantify the proteolytic activity under various conditions

  • Assess the impact of mutations on enzyme function

  • Investigate functional homologs in other bacterial species

For Alkalilimnicola ehrlichei HtpX studies, adapting these model substrate systems to account for species-specific differences in substrate recognition would be a prudent methodological consideration.

What role does metal ion binding play in HtpX function and how can it be experimentally investigated?

Metal ion binding critically influences HtpX function, with distinct roles for different ions:

  • Zinc (Zn²⁺): Essential for catalytic activity, as demonstrated when purified HtpX supplemented with Zn²⁺ exhibits self-cleavage activity and can degrade substrates like casein and SecY . During purification, using zinc chelators prevents premature self-degradation .

  • Calcium (Ca²⁺): Binding of Ca²⁺ to recombinant HtpX results in formation of the largest active pocket, suggesting a structural role in optimizing catalytic efficiency .

Experimental approaches to investigate these metal interactions include:

  • Tertiary structure prediction using tools like AlphaFold3

  • Analysis of binding pockets using CASTpFold (http://sts.bioe.uic.edu/castp/index.html)

  • Visualization of structural changes using PyMOL

  • Metal-substitution experiments to determine ion specificity

  • Activity assays in the presence and absence of specific metal ions

What molecular mechanisms underlie HtpX's role in membrane protein quality control?

HtpX functions as a key component in bacterial membrane protein quality control through several mechanisms:

  • Recognition of misfolded membrane proteins: HtpX appears to target proteins that fail to maintain proper folding or assembly within the membrane .

  • Complementary activity with FtsH: HtpX works in conjunction with the ATP-dependent protease FtsH, potentially providing compensatory or complementary proteolytic activity .

  • Zinc-dependent proteolysis: The metalloprotease activity depends on zinc coordination, allowing for specific cleavage of target proteins .

  • Membrane localization: The integral membrane nature of HtpX positions it ideally to access and process membrane protein substrates that require degradation .

Experimental approaches to further investigate these mechanisms include:

  • Designing reporter substrates that can reveal the sequence and structural determinants of HtpX substrate recognition

  • Co-expression studies with FtsH to identify synergistic effects

  • Site-directed mutagenesis of conserved HtpX domains to determine their contribution to substrate selectivity and proteolytic efficiency

What are the optimal conditions for recombinant expression and purification of active HtpX?

Based on extensive experimental optimization, the following conditions maximize yield and activity of recombinant HtpX:

Expression:

  • Host strain: E. coli BL21(DE3) has proven most effective for high-yield production

  • Vector system: pET-derived vectors with C-terminal His-tags facilitate purification without compromising activity

  • Induction conditions: IPTG at a final concentration of 1 mM when culture reaches OD600 ≈ 0.6–0.8

Purification:

  • Membrane extraction: Octyl-β-d-glucoside has proven effective in solubilizing HtpX while maintaining its stability

  • Denaturing conditions: Initial purification under denaturing conditions followed by refolding in the presence of zinc chelators prevents self-degradation

  • Chromatography sequence: Optimal results come from sequential cobalt-affinity, anion-exchange, and size-exclusion chromatography

  • Metal supplementation: Addition of Zn²⁺ post-purification restores proteolytic activity

For Alkalilimnicola ehrlichei HtpX specifically, these protocols may require modification based on species-specific protein properties.

How can site-directed mutagenesis be used to investigate HtpX function?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships of HtpX:

  • Target residues for mutation:

    • Zinc-binding motifs to confirm their role in catalysis

    • Conserved residues within the M48 peptidase domain

    • Transmembrane segments to investigate membrane topology

    • Potential calcium-binding sites to explore structural regulation

  • Functional assays for mutants:

    • In vivo protease activity using model substrates like XMS1

    • Self-cleavage assays in the presence of zinc

    • Degradation assays using known substrates such as casein or SecY

  • Structural analysis of mutants:

    • Changes in metal binding using spectroscopic methods

    • Alterations in thermal stability

    • Modifications to active site geometry using computational modeling

This methodological approach has successfully identified differential protease activities among HtpX mutants with modifications in conserved regions .

What techniques are most effective for studying HtpX-substrate interactions?

Understanding HtpX-substrate interactions requires specialized approaches given the membrane-bound nature of both the protease and many of its substrates:

  • Development of model substrates:

    • Engineering fusion proteins containing potential cleavage sites

    • Creating reporter systems that signal proteolytic activity

  • In vivo verification methods:

    • Overexpression of both HtpX and potential substrate proteins to confirm cleavage (as demonstrated with SecY)

    • Zymography analysis to visualize proteolytic activity against specific substrates

  • Structural characterization:

    • Tertiary structure prediction using tools like AlphaFold3

    • Active site pocket analysis using CASTpFold

    • Computational docking to predict substrate binding conformations

  • Analysis of cleavage products:

    • SDS-PAGE analysis of fragmentation patterns

    • Mass spectrometry to identify precise cleavage sites

    • Western blotting to track tagged fragments

These approaches collectively provide comprehensive insights into substrate specificity and the molecular mechanisms of HtpX-mediated proteolysis.

What are the primary technical challenges in studying recombinant Alkalilimnicola ehrlichei HtpX?

Researchers face several significant technical challenges when working with this protease:

  • Self-degradation: HtpX undergoes self-degradation upon cell disruption or membrane solubilization, necessitating specialized purification strategies .

  • Membrane localization: As an integral membrane protein, extraction and maintenance of structural integrity during purification require careful optimization of detergent conditions .

  • Metal dependence: The requirement for zinc in catalytic activity presents challenges for purification, as premature activation can lead to degradation during the purification process .

  • Limited structural data: Comprehensive structural information specific to Alkalilimnicola ehrlichei HtpX remains limited, complicating structure-based functional studies.

  • Organism-specific properties: Extrapolating from better-characterized HtpX homologs may miss species-specific functional attributes of the Alkalilimnicola ehrlichei variant.

Addressing these challenges requires integration of multiple complementary approaches and careful optimization of experimental conditions for this specific protease.

How can sequence-structure-function relationships be effectively established for HtpX proteases?

Establishing comprehensive sequence-structure-function relationships for HtpX proteases requires:

  • Comparative sequence analysis:

    • Alignment of HtpX sequences across bacterial species

    • Identification of conserved domains and variable regions

    • Correlation of sequence variations with functional differences

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM studies (facilitated by optimized purification protocols)

    • Homology modeling based on related structures

    • Molecular dynamics simulations to investigate conformational dynamics

  • Functional characterization:

    • Systematic mutagenesis of conserved residues

    • Cross-species complementation studies

    • Substrate specificity profiling across variants

  • Integration of computational and experimental data:

    • Structure prediction validation through experimental approaches

    • Correlation of predicted active site geometry with measured enzyme kinetics

    • Refinement of models based on functional assay results

The recent availability of milligram quantities of purified HtpX opens new possibilities for structural studies that will be essential for understanding the catalytic mechanism of this membrane peptidase and its related family members .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.