Recombinant Alkaline ceramidase (W02F12.2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

Gene Symbol: W02F12.2
Organism: Caenorhabditis elegans (roundworm)
Protein Name: Alkaline Ceramidase (UniProt: O45145)
Gene Type: Protein-coding
EC Number: 3.5.1.23
Function: Hydrolyzes ceramides into sphingosine and free fatty acids, influencing sphingolipid-mediated cellular processes such as apoptosis and signal transduction .

Key Gene Features:

FeatureDetail
Entrez Gene ID189124
mRNA AccessionNM_072296.5, NM_072296.6
Protein AccessionNP_504697.2
OrthologsACER2 (human), Acer2 (mouse), LOC100331179 (zebrafish)

Recombinant Protein Production

Recombinant W02F12.2 is produced using Escherichia coli expression systems, ensuring high purity and activity for research applications .

Enzymatic Activity:

  • Substrate Specificity: Prefers long-chain ceramides (e.g., C24:1, C18:1) over short-chain species .

  • Cofactor Requirement: Calcium (Ca²⁺) enhances activity, as observed in human ortholog ACER2 .

  • Optimal pH: Alkaline conditions (pH 8.0–9.0) .

Functional Studies

  • Sphingolipid Metabolism: Used to study ceramide-to-sphingosine conversion in C. elegans models .

  • Apoptosis Regulation: Overexpression or knockdown assays explore its role in programmed cell death pathways .

Technical Applications

  • ELISA and Immunoassays: Available as a recombinant protein for antibody validation and quantitative assays .

  • Protein-Protein Interaction Studies: Tagged versions facilitate pull-down assays to identify binding partners .

Regulatory and Functional Insights

  • Localization: Predominantly localized to the Golgi apparatus in eukaryotic cells (based on human ACER2 data) .

  • Role in Disease: While direct links in C. elegans remain understudied, human ACER2 is implicated in cancer and glycosylation disorders .

Future Directions

Current research gaps include structural characterization of the C. elegans enzyme and its role in aging or stress responses. Comparative studies with mammalian orthologs could further elucidate evolutionary conservation of sphingolipid pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
W02F12.2; Alkaline ceramidase; AlkCDase; Alkaline N-acylsphingosine amidohydrolase; Alkaline acylsphingosine deacylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
W02F12.2
Target Protein Sequence
MESSSINRWFEYESGHAWCESAYKYQTLPYVAEFANTCTNLPIIVLPLVNIMLLRRYLHD VNGGLIFPQLLLTFNGLASTYYHATLNLFGQLVDELSLVWIITVFLVVYIPVMKWFPEKF SKRLTLVRWVVLIVTALVSGLCFLEPNLNAIALMLFSIPAAVVINYEGKQSGIPDIESFP SRILALWGVAFSFWFADRLLCDFWLYLGTPYLHALFHLLAGLAGYTIFIMFSMIDIESRT KTHKYTAAVRYFPGKNGSIFSFPYISLKERSQ
Uniprot No.

Target Background

Function
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Database Links

KEGG: cel:CELE_W02F12.2

STRING: 6239.W02F12.2

UniGene: Cel.2046

Protein Families
Alkaline ceramidase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is alkaline ceramidase and what distinguishes it from other ceramidases?

Alkaline ceramidase is an integral membrane protein that catalyzes the hydrolysis of ceramides to sphingosine and free fatty acids at alkaline pH. Unlike acid ceramidases (which function optimally at acidic pH) or neutral ceramidases, alkaline ceramidases have a narrow pH optimum in the range of 7.5-9.0, with activity declining sharply below pH 7.0 or above pH 9.5. In humans, three alkaline ceramidases have been identified (ACER1, ACER2, and ACER3), which differ in their tissue distribution, subcellular localization, and substrate preferences. Alkaline ceramidases belong to the CREST superfamily of integral membrane hydrolases, which also includes adiponectin receptors that play roles in energy metabolism .

What cellular functions are regulated by alkaline ceramidases?

Alkaline ceramidases play critical roles in multiple cellular processes through their ability to modulate the balance between ceramides and sphingosine/sphingosine-1-phosphate (S1P). Moderate expression of ACER2, for example, promotes cell proliferation and survival by decreasing levels of ceramides while elevating levels of S1P. Interestingly, high expression of ACER2 causes fragmentation of the Golgi complex and inhibits cell proliferation due to aberrant increases in sphingosine levels. ACER2 also regulates protein glycosylation in the Golgi complex, influencing processes such as integrin β1-mediated cell adhesion to extracellular matrices. Additionally, ceramidases are involved in cell fate decisions, membrane integrity, and various signaling pathways .

How do the substrate specificities differ among alkaline ceramidase subtypes?

Different alkaline ceramidase subtypes exhibit distinct substrate preferences:

CeramidasePreferred SubstratesSubcellular LocalizationNotable Characteristics
ACER1Very long-chain ceramidesEndoplasmic reticulumHighly expressed in skin
ACER2Various ceramide species including d-e-C24:1-ceramideGolgi complexRequires Ca²⁺ for activity
ACER3Unsaturated ceramidesGolgi complex/ERZn²⁺-dependent amidase

ACER2 has been shown to catalyze the hydrolysis of various ceramide species and follows Michaelis-Menten kinetics. ACER3 shows specificity toward certain ceramide structures, and this specificity is related to the conserved catalytic residues in the active site .

What expression systems are optimal for producing recombinant alkaline ceramidase?

For functional characterization of alkaline ceramidases, yeast mutant cells (Δypc1Δydc1) lacking endogenous ceramidase activity have proven to be an excellent expression system. This approach ensures that any ceramidase activity detected is solely attributable to the recombinant enzyme. The expression can be driven by vectors such as pYES2 under the control of a galactose-inducible promoter. For mammalian expression, vectors like pcDNA3-FLAG or pcDNA4-FLAG can be used for transient expression in cells such as HEK293 or HeLa. The choice of expression system should consider the need for post-translational modifications and proper membrane insertion, as alkaline ceramidases are integral membrane proteins with multiple transmembrane domains .

How can recombinant alkaline ceramidase be purified while maintaining its activity?

Purification of active recombinant alkaline ceramidase typically involves:

  • Isolation of microsomes from expression systems via differential centrifugation

  • Solubilization of the membrane-bound enzyme using mild detergents (e.g., 0.3% Triton X-100)

  • Affinity purification using tags (e.g., FLAG, His) incorporated into the recombinant protein

  • Buffer optimization to include required cofactors (Ca²⁺ for ACER2, Zn²⁺ for ACER3)

  • Storage at appropriate pH (7.5-9.0 for optimal activity)

When designing purification protocols, it's critical to maintain the native conformation of the enzyme by avoiding harsh solubilization conditions. Additionally, including protease inhibitors during purification helps prevent degradation of the recombinant protein .

What methodologies are employed to measure alkaline ceramidase activity in vitro?

Alkaline ceramidase activity can be measured by quantifying the release of sphingosine (SPH) from ceramide substrates. A typical protocol involves:

  • Preparing substrate by dispersing ceramides in buffer containing 0.3% Triton X-100 using water bath sonication

  • Boiling the lipid/detergent mixture for 30 seconds and immediately chilling on ice to form homogeneous micelles

  • Mixing with microsomes containing the recombinant enzyme

  • Incubating at 37°C for 20 minutes (ensuring reaction time and enzyme amount are within linear range)

  • Stopping the reaction by boiling

  • Adding an internal standard (e.g., d-e-C17-SPH)

  • Analyzing sphingosine levels using techniques such as HPLC or LC-MS/MS

For kinetic analysis, varying substrate concentrations are used, and data are fitted to the Michaelis-Menten equation to determine parameters such as Km and Vmax .

How do metal ions impact the activity of alkaline ceramidases?

Different alkaline ceramidases have distinct metal ion requirements:

ACER2 requires Ca²⁺ for optimal activity. In in vitro assays, ACER2 exhibits minimal ceramidase activity in the absence of CaCl₂, but activity increases with rising CaCl₂ concentrations. Other cations affect ACER2 differently: Zn²⁺ or Cu²⁺ inhibit basal ceramidase activity, while Mg²⁺ or Mn²⁺ have no effect .

ACER3 functions as a Zn²⁺-dependent amidase. The enzyme contains a zinc-binding active site formed by conserved residues of the CREST motif. ACER3 is specifically inhibited by trichostatin A, an HDAC inhibitor that strongly chelates zinc, further supporting its Zn²⁺-dependent mechanism .

These metal ion dependencies are crucial considerations when designing buffers for activity assays or structural studies of alkaline ceramidases.

What are the kinetic parameters of recombinant alkaline ceramidase activity?

The hydrolysis of ceramides by alkaline ceramidases follows Michaelis-Menten kinetics. For ACER2, using d-e-C24:1-ceramide as a substrate at optimal pH and calcium concentration, kinetic parameters can be determined through nonlinear regression analysis. Though specific Km and Vmax values may vary based on experimental conditions and substrate types, these parameters provide valuable insights into enzyme efficiency and substrate preference.

When analyzing kinetic data, it's essential to ensure that:

  • The enzyme concentration is constant across assays

  • Reaction times are within the linear range

  • Substrate concentrations span an appropriate range (typically 0.2-5 × Km)

  • Proper controls are included to account for spontaneous hydrolysis

This approach enables quantitative comparison of how mutations or regulatory factors affect catalytic efficiency .

What is known about the membrane topology of alkaline ceramidases?

ACER2 has been characterized as having 7 putative transmembrane domains (TMDs) with a specific orientation in the Golgi membrane. Studies have determined that the amino (N) terminus is oriented in the lumen of the Golgi complex, while the carboxyl (C) terminus faces the cytosol. This topology is critical for proper enzyme function.

The N-terminal tail (first 36 amino acid residues) of ACER2 plays a crucial role in both enzyme activity and proper localization to the Golgi complex. ACER2 mutants lacking this N-terminal tail (ACER2ΔN36) exhibit undetectable activity and mislocalize to the endoplasmic reticulum. Interestingly, mutants lacking only the first 13 residues (ACER2ΔN13) retain ceramidase activity despite being mislocalized to the endoplasmic reticulum, suggesting that different regions of the N-terminal tail have distinct functions .

What catalytic residues are essential for alkaline ceramidase function?

Alkaline ceramidases belong to the CREST superfamily, which conserves a set of critical residues: three histidines, one aspartate, and one serine. In ACER3, mutational studies of these conserved residues revealed their essential roles in catalysis:

ResidueFunctionEffect of Mutation
Histidines (3)Zinc coordinationComplete loss of activity
AspartateStabilization of active siteComplete loss of activity
Serine (S77)Stabilization of oxyanion transition state600-fold decrease in activity (S77A)

The S77C mutation in ACER3 shows pH-sensitive activity, with neutral pH partially recovering enzyme function. This pH dependency supports the role of S77 in stabilizing the oxyanion of the transition state during catalysis, differing from its proposed role in zinc coordination in adiponectin receptors .

How does the catalytic mechanism of alkaline ceramidases compare to other amidases?

Alkaline ceramidases (particularly ACER3) function as Zn²⁺-dependent amidases, sharing mechanistic similarities with other zinc-based amidases. The proposed catalytic mechanism involves:

  • Zinc coordination by three conserved histidine residues, positioning and activating the water molecule for nucleophilic attack

  • Nucleophilic attack on the amide bond of ceramide

  • Formation of a tetrahedral oxyanion intermediate stabilized by the conserved serine residue

  • Breakdown of the intermediate, releasing sphingosine and fatty acid

This mechanism differs from acid ceramidases, which employ a covalent enzyme-substrate intermediate during catalysis. The CREST superfamily's unique arrangement of active site residues enables efficient hydrolysis of the amide bond despite the challenging environment of the membrane .

How is alkaline ceramidase expression and activity regulated in cells?

Alkaline ceramidase expression and activity are regulated through multiple mechanisms:

  • Transcriptional regulation: ACER2 expression is upregulated in cells by serum deprivation and all-trans-retinoic acid, but downregulated by the tumor promoter phorbol 12-myristate 13-acetate, suggesting transcriptional control in response to environmental cues.

  • Post-translational modifications: Though not fully characterized, various PTMs likely influence enzyme activity and localization.

  • Subcellular localization: Proper localization to the Golgi complex (for ACER2) is essential for normal function. Mislocalization affects not only ceramide metabolism but also downstream cellular processes like protein glycosylation.

  • Cofactor availability: Fluctuations in Ca²⁺ (for ACER2) or Zn²⁺ (for ACER3) levels in the appropriate cellular compartments can modulate enzyme activity.

  • Substrate accessibility: The membrane environment and lipid composition influence substrate presentation and enzyme access .

What role do alkaline ceramidases play in sphingolipid metabolism and signaling?

Alkaline ceramidases occupy a pivotal position in sphingolipid metabolism by catalyzing the conversion of ceramides to sphingosine, which can be subsequently phosphorylated to form sphingosine-1-phosphate (S1P). This conversion has significant implications for cellular signaling:

  • Ceramide reduction: By hydrolyzing ceramides, these enzymes reduce levels of these pro-apoptotic molecules, potentially promoting cell survival.

  • S1P generation: The released sphingosine can be phosphorylated to S1P, which promotes cell proliferation, survival, and migration through both intracellular targets and cell-surface S1P receptors.

  • Sphingolipid rheostat: Alkaline ceramidases help maintain the balance between pro-apoptotic ceramides and pro-survival S1P, influencing cell fate decisions.

  • Secretion regulation: Overexpression of ACER2 or ACER2ΔN13 increases the release of S1P from cells, affecting not only the expressing cell but potentially surrounding cells through paracrine signaling .

How do specific mutations impact alkaline ceramidase activity and cellular localization?

Mutational studies have provided valuable insights into structure-function relationships of alkaline ceramidases:

MutationEffect on ActivityEffect on LocalizationPhysiological Impact
ACER2ΔN36 (lacking first 36 residues)Undetectable activityMislocalized to ERCannot increase S1P release
ACER2ΔN13 (lacking first 13 residues)Retains ceramidase activityMislocalized to ERCan still increase S1P release
ACER3 H81A/H217A/H221A (conserved histidines)Complete loss of activityNot reportedDisrupts zinc coordination
ACER3 S77A (conserved serine)600-fold decreaseNot reportedImpairs transition state stabilization
ACER3 S77CpH-sensitive activityNot reportedPartial recovery at neutral pH

These findings demonstrate that different domains serve distinct functions in enzyme activity, localization, and downstream cellular effects. The N-terminal region of ACER2 is particularly important for proper Golgi localization, while conserved catalytic residues are essential for enzymatic function regardless of localization .

What techniques are employed to analyze the structure-function relationship of alkaline ceramidases?

Several complementary approaches are used to investigate structure-function relationships:

  • Site-directed mutagenesis: Targeted mutation of specific residues (e.g., conserved histidines, aspartate, and serine) to determine their roles in catalysis and structure.

  • Domain swapping and truncation: Creation of chimeric proteins or deletion mutants (e.g., ACER2ΔN36, ACER2ΔN13) to identify functional domains.

  • Activity assays with purified enzymes: Quantitative measurement of wild-type and mutant enzyme activities under various conditions to determine kinetic parameters.

  • Subcellular localization studies: Fluorescence microscopy with tagged proteins to track localization patterns of wild-type and mutant enzymes.

  • Structural modeling: Homology modeling based on related proteins (e.g., adiponectin receptors) to predict structural features and guide mutagenesis.

  • pH and metal ion dependence studies: Testing activity across pH ranges and with different metal ions to understand the catalytic environment requirements .

How can recombinant alkaline ceramidase be utilized in therapeutic development?

Recombinant alkaline ceramidase has several potential applications in therapeutic development:

  • Drug screening platform: Purified enzymes can be used in high-throughput screens to identify inhibitors or activators with potential therapeutic value.

  • Biomarker development: Understanding ceramidase activity patterns in disease states can lead to diagnostic or prognostic biomarkers.

  • Enzyme replacement therapy: For conditions involving ceramidase deficiency, recombinant enzymes might serve as replacement therapies.

  • Structure-based drug design: Crystal structures or reliable models of alkaline ceramidases can guide the development of specific modulators targeting active sites or regulatory domains.

  • Cell-based therapy optimization: Manipulating ceramidase activity in therapeutic cells (e.g., stem cells, CAR-T cells) might enhance their survival or function in challenging environments .

What are the most significant technical challenges when working with recombinant alkaline ceramidases?

Researchers working with alkaline ceramidases face several technical challenges:

  • Protein expression and purification: As integral membrane proteins with multiple transmembrane domains, alkaline ceramidases are challenging to express at high levels and purify in active form.

  • Maintaining enzymatic activity: Proper folding and membrane insertion are critical for activity, requiring careful optimization of expression systems and purification protocols.

  • Substrate preparation: Ceramides are highly hydrophobic and require proper solubilization (e.g., with detergents like Triton X-100) to create accessible substrates for in vitro assays.

  • Assay sensitivity: Detection of enzymatic products (sphingosine) often requires specialized analytical techniques like HPLC or mass spectrometry.

  • Cofactor requirements: Ensuring proper concentrations of required metal ions (Ca²⁺ for ACER2, Zn²⁺ for ACER3) in assay buffers is essential for accurate activity measurements.

  • Distinguishing isoform activities: When studying specific isoforms in complex biological samples, strategies to distinguish between different ceramidase activities are necessary .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.