Recombinant Alkaline ceramidase (CBG18997)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant ACER3 is typically expressed in Saccharomyces cerevisiae mutant strains lacking endogenous ceramidase activity to ensure functional isolation . The enzyme contains a conserved CREST motif (three histidine residues, one aspartate, and one serine) that forms a Zn²⁺-dependent active site . Key structural and catalytic features include:

  • Zn²⁺ coordination: His81, His217, and His221 residues bind Zn²⁺, essential for catalytic activity .

  • Substrate specificity: Prefers ceramides with unsaturated long acyl chains (C18:1 or C20:1) .

Catalytic Mechanism

ACER3 hydrolyzes ceramides via a Zn²⁺-dependent general acid-base mechanism :

  1. Water activation: Asp92 deprotonates a water molecule, enabling nucleophilic attack on the ceramide amide bond .

  2. Oxyanion stabilization: Ser77 forms hydrogen bonds with the carbonyl oxygen, stabilizing the transition state .

  3. Product release: Collapse of the tetrahedral intermediate releases sphingosine and a free fatty acid .

Mutagenesis studies confirm that substitutions (e.g., H81A, D92A) abolish activity, while S77A reduces activity by 600-fold .

Biochemical Properties

ParameterValue (Mean ± SD)Substrate UsedExperimental ConditionsSource
K<sub>M</sub>15.48 ± 1.25 µMNBD-C12-phytoceramidepH 9.0, 37°C, yeast microsomes
V<sub>MAX</sub>46.94 ± 0.90 pmol/min/mgNBD-C12-phytoceramidepH 9.0, 37°C, yeast microsomes

Inhibitor Development

ACER3 is selectively inhibited by:

  • Trichostatin A (TSA): A Zn²⁺ chelator that acts as a mixed inhibitor (K<sub>i</sub> = 0.5 µM) .

  • Compound 02: A small molecule that binds transmembrane domains (TM1, TM5) and elevates cellular ceramide levels (EC<sub>50</sub> = 3.2 µM) .

Neurodegenerative Diseases

ACER3 deficiency causes Purkinje cell degeneration in mice and progressive leukodystrophy in humans . Restoring its activity could mitigate ceramide accumulation linked to neuronal apoptosis .

Cholestatic Liver Injury (CLI)

In female mice, ACER3 ablation increases ceramide(d18:1/18:1), which activates liver X receptor β (LXRβ) to reduce bile acid toxicity . Recombinant ACER3 modulation shows sex-specific therapeutic potential for CLI .

Cancer

ACER3 upregulation in tumors promotes sphingosine-1-phosphate (S1P) production, driving angiogenesis and metastasis . Inhibitors like Compound 02 block this pathway, inducing cancer cell apoptosis .

Limitations and Future Directions

  • Structural ambiguity: Despite homology modeling, full-length ACER3’s membrane topology remains unresolved .

  • Substrate diversity: Kinetic parameters for natural ceramides (e.g., C18:1-ceramide) are underexplored .

  • Delivery challenges: As a membrane protein, recombinant ACER3 requires advanced formulation for therapeutic use .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
CBG18997; Alkaline ceramidase; AlkCDase; Alkaline N-acylsphingosine amidohydrolase; Alkaline acylsphingosine deacylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG18997
Target Protein Sequence
MDSSSISRWFEYESGHAWCESAYKYQTLPYVAEFANTCTNLPIIVLPLVNIMLLRRYLHD VNGGLVFPQLLLTFNGLASTYYHATLNLFGQLVDELSLVWIITVFLVVYIPVMKWFPERF SKRLTVVRWVVLIVTAVVSALCFLEPNLNAIALMLFSIPAAVVIRYEGKQSGIPDIENFP SRILALWGVAFSFWFADRLLCDFWLYLGTPYLHALFHLLAGLAGYTIFIMFSMIDIESRS KTHRYTAAVRYFPDKNGSIFSFPYISLKERSQ
Uniprot No.

Target Background

Function

Function: Hydrolyzes the sphingolipid ceramide into sphingosine and a free fatty acid.

Database Links

STRING: 6238.CBG18997

Protein Families
Alkaline ceramidase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Alkaline ceramidase and how does it function in sphingolipid metabolism?

Alkaline ceramidase is a key enzyme that catalyzes the hydrolysis of ceramide into sphingosine and free fatty acids with an optimal pH of approximately 9.0 . This reaction represents a critical regulatory point in sphingolipid metabolism, controlling the balance between ceramide (which generally promotes apoptosis) and sphingosine, which can be phosphorylated to form sphingosine-1-phosphate (S1P) . The interconversion between these bioactive lipids fundamentally influences cellular processes including proliferation, differentiation, and programmed cell death . Alkaline ceramidases thus serve as gatekeepers for maintaining ceramide homeostasis within cells, with significant implications for both normal physiology and disease states .

What are the different types of Alkaline ceramidases and where are they expressed?

In humans, three distinct alkaline ceramidases have been identified:

  • ACER1: A 31 kDa protein (264 amino acids) primarily expressed in the skin, particularly in differentiated interfollicular epidermis, sebaceous gland, and infundibulum . It is localized to the endoplasmic reticulum (ER) .

  • ACER2: A 31 kDa membrane protein (275 amino acids) with seven putative transmembrane domains, predominantly found in the placenta, pancreas, and heart . ACER2 is primarily localized to the Golgi complex .

  • ACER3: Located at chromosome 11q13.5, ACER3 is ubiquitously expressed but shows notably high expression in placental tissue . It is distributed between the ER and Golgi complex .

These distribution patterns suggest specialized functions for each isoform in different tissues, with ACER1 being particularly important in skin biology, while ACER2 and ACER3 may have broader roles across multiple organ systems .

What are the optimal conditions for Alkaline ceramidase activity in laboratory settings?

Alkaline ceramidases function optimally at pH 9.0 and 37°C, conditions that should be maintained in experimental settings for maximum enzyme activity . Specifically for ACER2, kinetic studies have determined Km values of approximately 94.8-98.5 μM for different ceramide substrates (C16:0-ceramide and C18:0-ceramide), with corresponding Vmax values of 0.0237 and 0.0261 nmol/min, respectively .

In typical experimental protocols, reaction mixtures for recombinant alkaline ceramidase assays contain:

  • Protein amount: Varies by specific enzyme (typically 5-50 ng of purified enzyme)

  • Substrate concentration: 40-200 μM depending on the application

  • Buffer: Appropriate alkaline buffer (pH ~9.0)

  • Incubation conditions: 37°C for 3 hours

For accurate activity measurement, researchers should carefully control temperature, pH, substrate concentration, and incubation time, as these parameters significantly influence enzyme kinetics .

How do Alkaline ceramidases differ from other ceramidases biochemically?

Ceramidases are classified based on their pH optima into three main categories, each with distinct biochemical properties:

PropertyAcid CeramidaseNeutral CeramidaseAlkaline Ceramidase
Optimal pH4.0-4.57.0-7.4~9.0
GeneASAH1 (Chr. 8p22)ASAH2 (Chr. 10q11.23)ACER1/2/3
Km value389-413.2 μM33.41-60.1 μM94.8-98.5 μM (ACER2)
Vmax33.33-462.97 nmol/min mg0.68 nmol/min mg0.0237-0.0261 nmol/min (ACER2)
Subcellular localizationLysosomesMitochondria, plasma membrane, GolgiER (ACER1, ACER3), Golgi (ACER2, ACER3)

These distinctive properties necessitate different experimental approaches when studying each ceramidase class . The alkaline ceramidases require specialized alkaline buffers and show different substrate preferences compared to acid and neutral ceramidases .

What are the most effective methods for measuring Alkaline ceramidase activity?

Several methodologies can be employed to measure alkaline ceramidase activity in research settings:

  • Fluorogenic substrate assays: Using substrates like RBM14 at 40 μM concentration in appropriate alkaline buffer systems . The reaction is typically incubated at 37°C for 3 hours, followed by addition of methanol to stop the reaction . Fluorescence measurements provide a quantitative readout of enzyme activity.

  • Cell-based assays: Cells are seeded (approximately 10^4 cells per well in 96-well plates), cultured for 24 hours, then incubated with fluorogenic substrate (40 μM, prepared from 4 mM stock solutions) for 3 hours at 37°C . This approach enables assessment of ceramidase activity in intact cellular systems.

  • qPCR for expression analysis: For measuring ACER expression rather than activity, researchers can employ qPCR using gene-specific primers. Reaction conditions typically involve an initial step of 10 minutes at 95°C, followed by 45 cycles of 10-second melting at 95°C and 30-second annealing/extension at 60°C . Expression levels are calculated using ΔCp values relative to a reference gene such as GAPDH.

These methods can be adapted for recombinant enzyme studies by using purified proteins under carefully controlled conditions .

How can recombinant Alkaline ceramidases be effectively expressed and purified?

Based on successful approaches with related ceramidases, recombinant alkaline ceramidases can be expressed and purified using the following strategies:

  • Expression systems: Insect cell lines (like Sf9) have been successfully used for ceramidase expression, as demonstrated with ASAH2 . Mammalian expression systems such as HEK293T and CHO cells have also proven effective for ceramidase expression .

  • Construct design: For alkaline ceramidases, constructs should include the full coding sequence with appropriate tags for purification. In some cases, focusing on specific domains (as done with ASAH2's extracellular domain, amino acids 99-780) may enhance expression while maintaining activity .

  • Activity verification: After expression, enzyme activity should be confirmed using appropriate substrates. For instance, recombinant human ASAH2 expressed in an insect Sf9 cell line showed a Km of 33.41 μM and Kcat of 61.93 min^-1 .

  • Glycosylation considerations: N-linked glycosylation can be crucial for ceramidase activity and stability. For example, human ASAH2 contains N-linked glycans at multiple asparagine residues in both catalytic and Ig-like domains .

The approach should be tailored to the specific alkaline ceramidase isoform being studied, with attention to optimizing expression conditions for maximum yield of functional enzyme.

How do Alkaline ceramidases contribute to disease pathology?

Alkaline ceramidases have been implicated in several pathological conditions through their regulation of the ceramide/sphingosine balance:

  • Cancer: ACER2 expression is regulated by tumor suppressor p53 and hypoxia-inducible factor 2α, suggesting roles in cancer progression . Increased ACER2 mRNA expression has been observed in human liver and colon cancer tissues compared to healthy samples . This may contribute to altered sphingolipid metabolism supporting cancer cell survival and proliferation.

  • Progressive leukodystrophy: ACER1 has been associated with this neurological condition, suggesting critical roles in myelin maintenance .

  • Metabolic disorders: Alterations in ceramidase activity affect ceramide levels, which are implicated in conditions like insulin resistance, type 2 diabetes, and nonalcoholic fatty liver disease . Neutral ceramidase (ASAH2) expression decreases in insulin resistance scenarios, leading to increased ceramide levels .

  • Neurodegenerative disorders: Accumulation of ceramide has been observed in Alzheimer's disease, with decreased S1P levels in human brain tissues . While most research has focused on ASAH2, alkaline ceramidases may also contribute to these pathologies through their impact on sphingolipid metabolism.

Understanding these disease associations provides potential targets for therapeutic intervention by modulating ceramidase activity.

What therapeutic strategies target Alkaline ceramidases?

While therapeutic approaches targeting alkaline ceramidases specifically are still emerging, strategies developed for other ceramidases provide valuable insights:

  • Inhibitor development: Several ceramidase inhibitors have been developed, including B-13, D-e-MAPP, and NOE . These compounds increase ceramide levels and can induce apoptosis in cancer cell lines, enhancing chemotherapy effectiveness .

  • Structural optimization: Structural modifications of existing inhibitors have generated more potent compounds. For example, derivatives of B-13 (such as LCL-464) show enhanced potency against ceramidases .

  • Repurposing approved drugs: Carmofur, an approved drug for colorectal cancer in Japan, has been identified as an ASAH1 inhibitor capable of crossing the blood-brain barrier, demonstrating effectiveness against glioblastoma cancer stem cells .

  • Gene therapy approaches: Experimental knockdown of ceramidases using siRNA has shown promise in cancer models, ameliorating tumor growth and increasing sensitivity to chemotherapy .

These approaches may be adapted to specifically target alkaline ceramidases, particularly in contexts where these enzymes contribute to disease pathology through excessive sphingosine/S1P production or ceramide depletion.

What are key considerations when designing experiments involving recombinant Alkaline ceramidases?

When designing experiments with recombinant alkaline ceramidases, researchers should consider:

  • pH optimization: Maintain reaction conditions at the optimal pH of approximately 9.0 to ensure maximum enzyme activity . Buffer selection is critical, as even small deviations from optimal pH can significantly affect kinetic parameters.

  • Substrate selection: Different ceramide substrates can yield varying kinetic parameters. For instance, ACER2 shows Km values of 98.5 μM for C16:0-ceramide and 94.8 μM for C18:0-ceramide . Using fluorogenic substrates (like RBM14) at 40 μM in appropriate buffer systems can provide sensitive detection .

  • Protein stability and storage: Recombinant ceramidases may require specific storage conditions to maintain activity. Consider the presence of disulfide bonds (as observed in the catalytic domain of ASAH2) and their potential sensitivity to reducing agents .

  • Glycosylation status: N-linked glycosylation can be crucial for ceramidase activity. Expression systems should be selected that provide appropriate post-translational modifications .

  • Controls and validation: Include appropriate controls such as heat-inactivated enzyme, known ceramidase inhibitors, or enzyme-free reactions. For cell-based assays, consider using ASAH2(-/-) mouse embryonic fibroblasts as negative controls .

  • Reaction kinetics monitoring: Plan for appropriate time points to monitor reaction progress, typically including a 3-hour incubation at 37°C for standard assays .

These considerations will help ensure reproducible and interpretable results when working with recombinant alkaline ceramidases.

How can researchers ensure specificity when targeting individual Alkaline ceramidase isoforms?

Ensuring isoform specificity when studying alkaline ceramidases requires:

  • Expression analysis: Employ qPCR with isoform-specific primers to confirm which ACER isoforms are expressed in your experimental system . Design primers that target unique regions of each isoform (ACER1, ACER2, ACER3).

  • Subcellular localization: Leverage the distinct subcellular localization patterns of different ACERs: ACER1 in the ER, ACER2 in the Golgi complex, and ACER3 in both ER and Golgi . Subcellular fractionation followed by activity assays can help distinguish isoform contributions.

  • Tissue-specific expression: Consider the tissue-specific expression patterns when selecting experimental models. ACER1 is predominantly expressed in skin, ACER2 in placenta, pancreas, and heart, while ACER3 is more ubiquitously expressed .

  • Genetic approaches: Use gene silencing (siRNA, shRNA) or gene editing (CRISPR-Cas9) techniques targeting specific ACER isoforms to confirm their roles. The phenotypic consequences of ACER1 deficiency have been demonstrated in mouse models, showing increased transepidermal water loss and aberrant hair shafts .

  • Isoform-selective inhibitors: While limited, any available isoform-selective inhibitors should be employed to pharmacologically distinguish between different alkaline ceramidases.

  • Substrate preferences: Exploit any known differences in substrate preferences between ACER isoforms when designing activity assays.

By combining these approaches, researchers can more confidently attribute observed effects to specific alkaline ceramidase isoforms rather than to ceramidase activity in general.

What are emerging areas of research involving Alkaline ceramidases?

Several promising research directions are emerging in the field of alkaline ceramidases:

  • Structure-function relationships: Following the successful X-ray crystallography of ASAH2 , similar structural studies of alkaline ceramidases would provide insights into their catalytic mechanisms and facilitate rational inhibitor design.

  • Role in metabolic diseases: Exploring the specific contributions of alkaline ceramidases to insulin resistance, type 2 diabetes, and nonalcoholic fatty liver disease represents an important research direction . While ceramide accumulation has been observed in these conditions, the precise roles of different ceramidase isoforms remain to be fully elucidated.

  • Neurodegenerative disorders: Investigating how alkaline ceramidases influence sphingolipid metabolism in the context of Alzheimer's disease and other neurodegenerative conditions could yield new therapeutic targets .

  • Cancer biology: Further research into how ACER2 contributes to cancer progression through regulation by p53 and hypoxia-inducible factor 2α may reveal novel intervention points .

  • Development of isoform-specific modulators: Creating compounds that selectively target individual alkaline ceramidase isoforms would advance both basic research and potential therapeutic applications.

These research directions will contribute to a more comprehensive understanding of alkaline ceramidases and their therapeutic potential across multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.