Recombinant Alkaliphilus metalliredigens Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Recombinant cobS is produced via heterologous expression in E. coli:

  1. Cloning: The cobS gene is inserted into a plasmid vector (e.g., pET series) under an inducible promoter (e.g., T7 promoter) .

  2. Induction: Cultures are grown to mid-log phase, followed by induction with isopropyl β-D-1-thiogalactopyranoside (IPTG).

  3. Purification: Histidine affinity chromatography is used to isolate the His-tagged protein .

Yield and Purity

  • Purity: >90% as determined by SDS-PAGE .

  • Storage: Lyophilized powder stored at -20°C/-80°C with 50% glycerol for stability .

Functional Insights and Catalytic Role

CobS is a key component in the cobalamin biosynthesis pathway:

Catalytic Mechanism

cobS facilitates the final step of adenosylcobalamin formation:
Adenosylcobinamide-GDP+RibazolecobSAdenosylcobalamin-GDP\text{Adenosylcobinamide-GDP} + \text{Ribazole} \xrightarrow{\text{cobS}} \text{Adenosylcobalamin-GDP}
This reaction is critical for producing active cobalamin, which serves as a cofactor in enzymatic processes such as methionine synthesis and DNA repair .

Research Gaps and Future Directions

  1. Functional Characterization: Kinetic studies (e.g., KmK_m, VmaxV_{max}) and substrate specificity remain unexplored.

  2. Structural Analysis: Crystallography or cryo-EM to elucidate binding interactions with ribazole and adenosylcobinamide-GDP.

  3. Synergistic Applications: Combining cobS with A. metalliredigens’ metal-reducing genes for bioremediation of cobalt/arsenic-contaminated alkaline sites .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Amet_3621; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Alkaliphilus metalliredigens (strain QYMF)
Target Names
cobS
Target Protein Sequence
MNIDMNRFISILQFLTRIPIKRDVPMEEAFHKGIIYFPVVGGIIGALLMVAYRGASLYLA HSLSALLTVGFFVFLTGGLHLDGLGDTFDGLYSNRNKETILEIMKDSRLGTNGVLAMVFI LLLKLYGIQGLGEHQIYWGIILMPVMGRQAIVYGCYRTIYGRSQGLGHLFIGKVSKKELL ISSLLTFILAAMHLPSLIFALLLPIGSQLYKGHVMKKIDGMTGDTLGSLCELTEGCYLLF ILLITGAGLF
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Alkaliphilus metalliredigens* catalyzes the two-step reaction involving adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Alkaliphilus metalliredigens and why is its cobalamin synthase significant?

Alkaliphilus metalliredigens strain QYMF is an anaerobic, alkaliphilic, and metal-reducing bacterium belonging to the phylum Firmicutes. It was isolated from alkaline borax leachate ponds with high concentrations of sodium (0.04-0.53 M) and boron (0.19-0.28 M) . This bacterium is significant because:

  • It grows optimally at pH 9.6 in the presence of elevated salt levels (20 g/L NaCl) and can tolerate pH values up to 11.0

  • It can utilize Fe(III)-citrate, Fe(III)-EDTA, Co(III)-EDTA, and Cr(VI) as electron acceptors with yeast extract or lactate as electron donors

  • It represents one of the few known metal-reducing microorganisms functioning in alkaline environments

Its cobalamin synthase is particularly significant because membrane association of this penultimate step in cobalamin biosynthesis is conserved among all cobamide producers, suggesting an important but not fully understood evolutionary advantage .

What is the function of cobalamin synthase (CobS) in the B12 biosynthetic pathway?

CobS (EC 2.7.8.26) is a polytopic integral membrane protein that catalyzes the penultimate step in coenzyme B12 (adenosylcobalamin) biosynthesis . Specifically:

  • It condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to generate adenosylcobalamin 5′-phosphate (AdoCbl-P)

  • This reaction represents a critical convergence point where the corrin ring and the lower ligand base are joined to assemble the nucleotide loop

  • The final step of the pathway involves dephosphorylation of AdoCbl-P by CobC phosphatase (EC 3.1.3.73) to yield adenosylcobalamin (AdoCbl)

This critical reaction connects two major branches of the cobalamin biosynthetic pathway, making CobS essential for both de novo synthesis and precursor salvaging .

How does the anaerobic cobalamin biosynthesis pathway in A. metalliredigens compare to other bacteria?

The cobalamin biosynthesis pathway exists in two variants: aerobic and anaerobic. A. metalliredigens, being a strict anaerobe, utilizes the anaerobic pathway, which differs from the aerobic pathway in several key aspects:

FeatureAnaerobic pathway (e.g., in A. metalliredigens, Salmonella)Aerobic pathway (e.g., in P. denitrificans)
Cobalt insertion timingEarly (at sirohydrochlorin stage)Late (after ring contraction)
Ring contraction mechanismOxygen-independentRequires molecular oxygen
Key enzymesCbiK, CbiL, CbiH, CbiF, CbiG, CbiD, etc.CobN, CobS, CobT, CobG, CobJ, etc.
First committed stepCobalt insertion into sirohydrochlorin by CbiKC-2 and C-7 methylation by CobA
Pathway intermediate after methylationCobalt-sirohydrochlorinPrecorrin-2

While there are notable differences in the early steps of corrin ring synthesis, the late steps involving nucleotide loop assembly (including the CobS-catalyzed reaction) are more conserved between the two pathways .

What are the optimal conditions for culturing A. metalliredigens QYMF?

For successful cultivation of A. metalliredigens QYMF, the following conditions are recommended:

  • Oxygen requirement: Strict anaerobe (requires anaerobic culturing techniques)

  • pH: Optimal at pH 9.6, can grow in the range of pH 7.5-11.0

  • Temperature: Optimal at 35°C, can grow between 4°C-45°C

  • Salinity: Optimal at 20 g/L NaCl, tolerates 0-80 g/L

  • Borate: Can grow in the presence of 2 g/L borate and tolerate up to 1.5% (w/v) borax (Na₂B₄O₇)

  • Electron donors: Yeast extract or lactate (yeast extract can stimulate growth with lactate or acetate)

  • Electron acceptors: Fe(III)-citrate, Fe(III)-EDTA, Co(III)-EDTA, or Cr(VI)

  • Not utilized: Does not use fumarate, nitrate, dimethyl sulfoxide, trimethylamine oxide, thiosulfate, sulfate, or various amino acids as electron acceptors

These specific growth conditions should be carefully maintained when cultivating this organism for subsequent CobS purification .

What genomic features of A. metalliredigens are relevant to cobalamin biosynthesis?

The genome sequence of A. metalliredigens QYMF reveals several features relevant to cobalamin biosynthesis:

  • As a metal-reducing bacterium, it possesses genes related to metal homeostasis that may interact with cobalt metabolism required for cobalamin synthesis

  • It contains genes encoding arsenical resistance proteins and two novel ars operons that encode arsenite efflux permeases (Acr3)

  • Though not directly related to cobalamin synthesis, its metal-reducing capabilities under alkaline conditions suggest unique adaptations that may influence metalloenzyme function, including those involved in B12 synthesis

  • Its aroA gene encodes 5-enopyruvylshikimate-3-phosphate synthase that has shown potential in developing glyphosate-resistant crops, indicating metabolic pathways that may intersect with aromatic amino acid synthesis and potentially with components of B12-dependent metabolic networks

A comprehensive analysis of its genome reveals metabolic capabilities adapted to alkaline, high-salt environments that may create a unique cellular context for cobalamin biosynthesis .

What expression systems are most effective for producing recombinant A. metalliredigens CobS?

Producing recombinant CobS presents significant challenges due to its membrane-associated nature and potential toxicity when overexpressed. Based on research with related CobS proteins:

  • Balanced expression systems are critical: The pRSFDUET-1 vector system has been used successfully for coexpression of CobS with proteins that mitigate its toxicity (e.g., CobC or PspA)

  • Induction conditions: IPTG concentrations must be carefully optimized; higher concentrations lead to greater toxicity

  • Host considerations: While E. coli has been used to express Salmonella CobS, the membrane composition differences between E. coli and A. metalliredigens should be considered, particularly given the alkaliphilic nature of the source organism

  • Purification approach: Membrane proteins like CobS require specialized purification protocols involving:

    • Gentle membrane solubilization with appropriate detergents

    • Affinity chromatography under conditions that maintain protein stability

    • Reconstitution into liposomes to maintain activity

For A. metalliredigens CobS specifically, adaptation to alkaline conditions (buffer systems at pH 8.0-9.0) may improve stability and activity of the recombinant protein given its native alkaliphilic environment .

How can the toxicity associated with CobS overexpression be mitigated in heterologous hosts?

Research with Salmonella CobS expressed in E. coli has revealed significant toxicity associated with CobS overexpression, but several strategies can mitigate these effects:

  • Co-expression approach: Co-expressing CobS with CobC (adenosylcobalamin 5′-phosphate phosphatase) or PspA (phage shock protein A) significantly counteracts the negative effects of CobS overproduction

  • Mechanism: Both CobC and PspA appear to stabilize membrane functionality disrupted by CobS overexpression

  • Expression system optimization: Using the pRSFDUET-1 vector allows balanced coexpression of CobS with CobC or PspA

  • Induction tuning: Carefully titrating inducer (IPTG) concentrations is essential; experimental data shows that balanced coexpression maintains cell viability across a range of inducer concentrations compared to CobS expression alone

Experimental evidence demonstrates that CobS overproduction negatively affects the proton motive force (PMF), membrane permeability, and cell viability. Both active and inactive CobS (D82A mutant) cause these effects, suggesting they result from membrane disruption rather than catalytic activity .

What methodologies are recommended for assaying CobS activity in vitro?

Assaying CobS activity requires specialized approaches due to its membrane association and the complex nature of its substrates. Based on studies with related CobS proteins:

  • Liposome reconstitution: CobS activity is enhanced when reconstituted into liposomes, suggesting membrane association is critical for optimal function

  • Substrate preparation: Both substrates must be prepared:

    • AdoCbi-GDP: Can be enzymatically synthesized from hydroxocobalamin using CobA, CobU and appropriate cofactors

    • α-RP: Generated using CobT from dimethylbenzimidazole and nicotinate mononucleotide

  • Activity measurement:

    • Direct assay: Monitoring the conversion of substrates to AdoCbl-P by HPLC analysis

    • Coupled assay: Including CobC to convert AdoCbl-P to AdoCbl, which can be detected by UV-visible spectroscopy (characteristic absorbance at 361 nm)

  • Control experiments: Include inactive CobS (e.g., D82A mutant) as a negative control

For quantitative analysis, high-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS) methods provide the most reliable measurements of product formation .

How does the alkaliphilic nature of A. metalliredigens affect the function and stability of CobS?

The alkaliphilic nature of A. metalliredigens likely imparts unique properties to its CobS enzyme compared to homologs from neutrophilic bacteria:

  • Membrane adaptation: A. metalliredigens thrives at pH 9.6 and tolerates up to pH 11.0, suggesting its membrane proteins, including CobS, have evolved specific adaptations for stability and function at high pH

  • Charge distribution: Alkaliphilic proteins often have altered surface charge distributions to maintain stability at high pH; this may affect substrate binding and catalytic mechanism in A. metalliredigens CobS

  • Metal coordination: The metal-reducing capabilities of A. metalliredigens suggest it has specialized metal homeostasis systems that may influence the handling of cobalt required for B12 synthesis

  • Research implications: When working with recombinant A. metalliredigens CobS:

    • Buffer systems should maintain pH 8.0-9.5 to preserve native-like conditions

    • Salt concentrations should reflect the high-salt environment from which the organism was isolated (optimally 20 g/L NaCl)

    • The presence of borate (2 g/L) may enhance stability as the organism was isolated from borax leachate ponds

These considerations are crucial when designing experimental systems to study this enzyme outside its native cellular environment .

What is the relationship between CobS and the phage shock protein response?

Research has revealed an intriguing connection between CobS overproduction and the phage shock protein (Psp) response:

  • Observation: Overproduction of CobS in E. coli triggers overproduction of phage shock protein A (PspA)

  • Mechanism: CobS overproduction dissipates the proton motive force (PMF) and decreases membrane stability, which are known triggers for the Psp response

  • Experimental evidence:

    • EtBr accumulation assays show increased uptake in cells overproducing CobS, indicating PMF dissipation

    • TO-PRO-3 uptake increases with CobS overproduction, demonstrating increased membrane permeability

    • DiOC₂ tests confirm decreased membrane potential

  • Functional relationship: Co-expression of PspA with CobS counteracts the negative effects on:

    • PMF maintenance

    • Cell membrane permeability

    • Cell viability

This relationship suggests an important physiological connection between cobalamin biosynthesis and membrane integrity maintenance systems, potentially indicating why the late steps of cobalamin biosynthesis are membrane-associated in all producing organisms .

How can liposomes be used to enhance CobS activity in experimental settings?

Liposome reconstitution is a powerful technique for studying membrane proteins like CobS:

  • Enhanced activity: CobS shows higher activity when reconstituted into liposomes compared to detergent-solubilized preparations, indicating the importance of the membrane environment for optimal function

  • Methodology:

    • Purify CobS using gentle detergents that maintain protein structure

    • Prepare liposomes from defined phospholipids (e.g., phosphatidylcholine, phosphatidylethanolamine, cardiolipin)

    • Mix detergent-solubilized CobS with liposomes

    • Remove detergent using adsorbent beads or dialysis

    • Verify reconstitution by density gradient centrifugation or proteoliposome flotation assays

  • Research findings: In vitro evidence shows that CobC phosphatase association with liposomes depends on the presence of CobS, suggesting they may form a functional complex on the membrane

  • Experimental advantage: Reconstituted systems allow precise control over membrane composition, facilitating studies on how lipid environment affects CobS activity and stability

This approach provides valuable insights into the physiological relevance of membrane association for CobS function and the potential formation of multienzyme complexes for cobalamin biosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.