Recombinant Alkaliphilus oremlandii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Alkaliphilus oremlandii ATP Synthase Subunit b (atpF)

Recombinant Alkaliphilus oremlandii ATP synthase subunit b (atpF) is a genetically engineered protein derived from the bacterium Alkaliphilus oremlandii . This protein is a subunit of the ATP synthase enzyme complex, which is crucial for the synthesis of adenosine triphosphate (ATP), the primary energy currency in cells . Alkaliphilus oremlandii is an alkaliphilic bacterium, meaning it thrives in highly alkaline environments . The ATP synthase in these bacteria has unique adaptations to function efficiently under such extreme conditions .

Function and Role of ATP Synthase Subunit b (atpF)

The ATP synthase enzyme, also known as F0F1-ATPase, is a complex molecular machine found in the cell membranes of bacteria, mitochondria, and chloroplasts . It utilizes the proton-motive force generated by the electron transport chain to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . Subunit b (atpF) is a critical component of the F0 sector of ATP synthase, which is embedded in the membrane . It functions as a stator, providing structural support and connecting the membrane-bound F0 sector to the F1 sector, where ATP synthesis occurs .

Production of Recombinant atpF Protein

Recombinant atpF protein is produced using genetic engineering techniques . The gene encoding atpF from Alkaliphilus oremlandii is inserted into an expression vector, which is then introduced into a host organism such as Escherichia coli . The host organism is cultured under controlled conditions to express the atpF protein, which is then purified using various chromatographic methods . Often, a His-tag is added to the atpF protein to facilitate purification using nickel affinity chromatography .

Characteristics of Recombinant atpF Protein

CharacteristicDescription
Source OrganismAlkaliphilus oremlandii
Protein Length167 amino acids (in the case of the Creative BioMart product)
TagN-terminal His tag (for purification)
Expression HostEscherichia coli
Molecular WeightApproximately 18-20 kDa (estimated)
Purity>90% (typically)
FormLiquid or lyophilized powder
ApplicationsBiochemical assays, structural studies, antibody production

ATP Synthase in Alkaliphilic Bacteria

ATP synthases in alkaliphilic bacteria exhibit unique characteristics that enable them to function effectively in high-pH environments . These adaptations are crucial for maintaining energy production and cellular homeostasis.

FeatureDescription
Proton-Motive Force (PMF)Reduced PMF due to reversed $$\Delta$$pH (acid inside relative to outside)
Sodium-Coupled ATP SynthaseSome alkaliphiles use Na+-coupled ATP synthases to generate a transmembrane electrical potential and control cytoplasmic Na+ levels
Membrane MicrocircuitsProximity of proton pumps and ATP synthases facilitates H+ transfers via membrane-associated microcircuits
Structural AdaptationsSpecific adaptations in the ATP synthase structure, such as a large number of c-subunits in the rotor ring, may enhance ATP synthesis efficiency

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Clos_2564; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs))
Target Names
atpF
Target Protein Sequence
MLGLVSFDATFFFQLANTLIMFLILKHFLFQPVTEFMDKRTKAIEESIAEAELKNKESNE LKAQYESKLTEIKKERTQIIDEAVRNAQKRGDEIVSAAGVEARRTIEKATAEIEREKQKM MNELKGEISQLAIAAAQKVIEKDLDQSAHQQMIQQFIDKAGETQWQN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core, and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Alkaliphilus oremlandii ATP synthase subunit b (atpF) and what are its key characteristics?

ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex in Alkaliphilus oremlandii, a bacterial species formerly classified as Clostridium oremlandii (strain OhILAs). The protein plays an essential structural and functional role in the F0 sector of ATP synthase, which is responsible for energy production via oxidative phosphorylation.

Key characteristics of the protein include:

ParameterSpecification
UniProt IDA8MJW3
Gene NameatpF (Clos_2564)
Amino Acid LengthFull length (1-167)
Amino Acid SequencemLGLVSFDATFFFQLANTLIMFLILKHFLFQPVTEFMDKRTKAIEESIAEAELKNKESNELKAQYESKLTEIKKERTQIIDEAVRNAQKRGDEIVSAAGVEARRTIEKATAEIEREKQKMMNELKGEISQLAIAAAAQKVIEKDLDQSAHQQMIQQFIDKAGETQWQN
Alternative NamesATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

The protein functions as part of the stator stalk that connects the F1 catalytic domain to the F0 membrane-embedded domain of ATP synthase, enabling the coupling of proton translocation to ATP synthesis .

How are recombinant forms of Alkaliphilus oremlandii ATP synthase subunit b typically produced?

Recombinant Alkaliphilus oremlandii ATP synthase subunit b is typically produced using Escherichia coli expression systems. The standard methodology follows these key steps:

  • Gene cloning: The atpF gene from Alkaliphilus oremlandii is amplified and cloned into an appropriate expression vector, often with an N-terminal His-tag to facilitate purification.

  • Transformation and expression: The recombinant plasmid is transformed into E. coli expression strains (common strains include DH10B, DK8 (Δatp), C41(DE3), C43(DE3), or BL21(DE3)) .

  • Culture conditions: Transformants are grown in nutrient-rich media such as 2× YT medium containing glucose and appropriate antibiotics at 37°C with shaking at ~200 rpm .

  • Protein purification: Following expression, the protein is typically purified using affinity chromatography (taking advantage of the His-tag), resulting in preparations with >90% purity as determined by SDS-PAGE .

  • Form and storage: The final product is often prepared as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, with recommended storage at -20°C/-80°C .

This methodology enables production of functional recombinant protein suitable for various biochemical and biophysical studies of ATP synthase structure and function .

What experimental approaches are optimal for studying ATP synthase function using recombinant Alkaliphilus oremlandii subunits?

Researchers investigating ATP synthase function using recombinant Alkaliphilus oremlandii subunits can employ several experimental approaches:

  • Reconstitution into proteoliposomes:

    • Incorporate purified recombinant ATP synthase subunit b along with other necessary components into artificial lipid vesicles

    • This system allows precise control of experimental conditions, including ion gradients and substrate concentrations

  • ADP/ATP exchange assays:

    • Fluorescence-based methods: Using fluorescent indicators such as Magnesium Green (MgGr) to monitor changes in Mg2+ concentration during ATP synthesis or hydrolysis

    • Radioactive methods: Employing 3H-labeled ATP to directly measure transport activity

The fluorescence-based protocol typically follows these steps:

  • Incubate proteoliposomes with fluorescent indicator (e.g., 3 µM MgGr), 1 mM MgCl2, and 2 mM ATP for 20 minutes at 4°C

  • Remove extraliposomal substrates via size-exclusion chromatography

  • Record fluorescence intensity in a plate reader

  • Initiate ADP/ATP exchange by adding 2 mM ADP to the buffer solution

  • Calculate ATP concentration inside proteoliposomes from the fluorescence signal

  • Inhibition studies: Using specific inhibitors like carboxyatractyloside (CATR) and bongkrekic acid (BA) to characterize transport mechanisms and binding sites

  • Membrane potential measurements: Establishing proton or sodium gradients to study ion-coupling mechanisms of ATP synthesis

These approaches provide complementary data to characterize the functional properties of ATP synthase and its components from Alkaliphilus oremlandii .

How do researchers address problems with protein stability and activity when working with ATP synthase subunits?

Maintaining stability and activity of ATP synthase subunits presents significant challenges. Researchers employ several strategies to address these issues:

  • Optimized storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Perform necessary aliquoting to avoid repeated freeze-thaw cycles

    • For working stocks, maintain at 4°C for no more than one week

  • Appropriate reconstitution protocols:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) when preparing for long-term storage

    • Standard practice often uses 50% glycerol as the final concentration

  • Buffer optimization:

    • Tris/PBS-based buffers with stabilizing agents (e.g., 6% Trehalose) at pH 8.0 have been found effective

    • For functional studies, buffer composition must be carefully selected to maintain protein activity while enabling meaningful measurements

  • Functional reconstitution:

    • When studying ATP synthase function, the complete complex or key interacting subunits must be co-reconstituted

    • In proteoliposome systems, lipid composition significantly affects protein stability and activity

    • Researchers must account for the random orientation of proteins in reconstituted systems, often by adding inhibitors before and after reconstitution

  • Activity verification:

    • SDS-PAGE analysis to confirm protein integrity (>90% purity is typically desired)

    • Functional assays to verify that the recombinant protein maintains native activity

    • Controls with specific inhibitors to confirm that measured activity is specific to the protein of interest

These approaches help ensure that experimental results accurately reflect the properties of ATP synthase rather than artifacts from protein degradation or inactivation .

What approaches can be used to analyze contradictory data when studying ATP synthase structure and function?

Contradictory data is a common challenge in ATP synthase research due to the complexity of the system. Researchers can employ the following methodological approaches to analyze and resolve inconsistencies:

  • Data contradiction classification:

    • Implement a structured notation for contradictions using parameters (α, β, θ), where:

      • α represents the number of interdependent items

      • β represents the number of contradictory dependencies defined by domain experts

      • θ represents the minimal number of required Boolean rules to assess these contradictions

    • This methodology helps organize inconsistent observations into manageable patterns

  • Types of contradictions to identify:

    • Type I: Different values of output variables with the same input variables

    • Type II: Same output values with different input variables

  • Data preparation and preprocessing:

    • Remove outliers based on statistical methods (e.g., Tukey's test)

    • Apply appropriate transformations (e.g., logarithmic normalization) to achieve more uniform data distributions

    • Use the Shapiro-Wilk test to verify normality of transformed data

  • Rule-based modeling:

    • Implement decision tree algorithms (DT) or rough sets algorithms (RST) to model data containing contradictions

    • These approaches can handle uncertainty and provide interpretable rules for understanding complex relationships

Using this structured approach, researchers studying ATP synthase can systematically identify the sources of contradictory results, distinguish between measurement errors and genuine biological variability, and develop models that account for inconsistencies in the experimental data .

What are the optimal protocols for reconstituting Alkaliphilus oremlandii ATP synthase components into proteoliposomes?

Reconstitution of ATP synthase components into proteoliposomes requires careful attention to multiple factors. The following detailed protocol is recommended based on successful approaches with similar ATP synthase systems:

  • Materials preparation:

    • Lipids: Typically, a mixture of phosphatidylcholine and phosphatidic acid (9:1 ratio) in chloroform

    • Buffer: 10 mM MOPS-NaOH, 2.5 mM MgCl2, pH 7.0

    • Purified protein components: ATP synthase subunit b (atpF) and other relevant subunits

    • Additional reagents: Fluorescent indicators (for functional studies), glycerol, biobeads

  • Lipid film preparation:

    • Evaporate the chloroform from lipid mixture under nitrogen stream

    • Further dry under vacuum for 3 hours to remove residual solvent

    • Hydrate the lipid film with reconstitution buffer to a final concentration of 10 mg/ml

  • Proteoliposome formation:

    • Add purified protein components to preformed liposomes at desired protein-to-lipid ratio (typically 1:50 to 1:100 weight ratio)

    • Incubate the mixture at 4°C for 30 minutes with gentle agitation

    • If studying ATP synthesis, include 3 µM MgGr, 1 mM MgCl2, and 2 mM ATP in the mixture

    • For detergent-mediated reconstitution, add detergent (e.g., Triton X-100) to destabilize liposomes, then remove using biobeads

  • Size homogenization:

    • Extrude the proteoliposome mixture through polycarbonate filters (typically 100-200 nm pore size)

    • Perform 15-20 passes to ensure uniform vesicle size

  • Removal of external components:

    • Perform size-exclusion chromatography using a Sephadex G-50 column

    • Collect the proteoliposome fraction (usually in the void volume)

  • Functional verification:

    • For ADP/ATP exchange studies, initiate the reaction by adding 2 mM ADP to the external medium

    • Monitor fluorescence changes over time to detect ATP/ADP exchange

    • Include controls with specific inhibitors (carboxyatractyloside and bongkrekic acid at 100 µM each) to account for protein orientation and confirm specificity

  • Storage:

    • Store prepared proteoliposomes at 4°C for immediate use

    • For longer storage, flash-freeze aliquots in liquid nitrogen and store at -80°C

This protocol has been successfully adapted for studying recombinant ATP synthase components and provides a reliable method for functional reconstitution that can be used to study transport properties and inhibitor sensitivity .

How can researchers accurately measure and compare ATP synthase activity across different experimental systems?

Accurate measurement and comparison of ATP synthase activity across different experimental systems require standardized protocols and careful attention to variables that may affect results. The following methodological approach ensures consistency and reliability:

  • Standardized activity assays:

    a. Fluorescence-based ADP/ATP exchange measurements:

    • Use Magnesium Green (MgGr) as an indicator at consistent concentration (3 µM)

    • Maintain consistent Mg2+ (1 mM) and nucleotide (2 mM) concentrations

    • Record fluorescence time course after addition of ADP

    • Calculate exchange rates from initial velocity of fluorescence change

    b. Radioactivity-based measurements:

    • Use 3H-labeled ATP at standardized specific activity

    • Terminate reactions at defined time points (e.g., 1, 20, and 60 minutes)

    • Remove external radioactivity via size exclusion chromatography

    • Quantify incorporated radioactivity by liquid scintillation counting

  • Controls and calibration:

    • Include protein-free liposomes as negative controls

    • Use known concentrations of ATP/ADP for calibration curves

    • Include specific inhibitors (CATR and BA) as functional controls

    • Normalize activity to protein content determined by consistent methods (e.g., Bradford assay)

  • Comparative analysis framework:

    ParameterProteoliposome SystemMembrane Vesicle SystemWhole Cell System
    Protein contentDefined (μg)Semi-defined (μg/mg membrane)Indirect (cell density)
    Activity unitsnmol ATP/min/μg proteinnmol ATP/min/mg membranenmol ATP/min/OD600
    AdvantagesPrecise controlNative membrane environmentPhysiological relevance
    LimitationsArtificial environmentMixed protein populationComplex regulation
    Normalization approachDirect protein quantificationMembrane protein contentCellular protein content
  • Data processing and statistical analysis:

    • Calculate specific activity (μmol ATP/min/mg protein)

    • Determine kinetic parameters (Km, Vmax) under defined conditions

    • Apply appropriate statistical tests (typically ANOVA with post-hoc comparisons)

    • Report results as mean ± standard deviation from at least three independent measurements

  • System-specific considerations:

    • For proteoliposomes: Account for random protein orientation

    • For membrane vesicles: Consider contribution of other ATP-consuming/producing enzymes

    • For whole cells: Address the complexity of cellular regulation and energy state

By implementing this standardized approach, researchers can generate comparable data across different experimental systems, enabling meaningful integration of results from complementary methodologies and facilitating the development of comprehensive models of ATP synthase function .

What are the emerging techniques that might advance our understanding of ATP synthase structure and function in extremophiles like Alkaliphilus oremlandii?

Several cutting-edge techniques are poised to revolutionize our understanding of ATP synthase in extremophiles like Alkaliphilus oremlandii:

  • Advanced structural biology approaches:

    • Cryo-electron tomography: Enables visualization of ATP synthase in its native cellular environment with near-atomic resolution

    • Time-resolved cryo-EM: Captures structural intermediates during the catalytic cycle

    • Integrative structural modeling: Combines data from multiple experimental techniques (X-ray crystallography, cryo-EM, mass spectrometry, etc.) to build comprehensive models

  • Single-molecule techniques:

    • Single-molecule FRET: Measures conformational changes during ATP synthesis/hydrolysis

    • Magnetic tweezers: Directly measures rotational torque generated by ATP synthase

    • Nanodiscs technology: Provides a more native-like membrane environment for studying individual ATP synthase complexes

  • Systems biology integration:

    • Multi-omics approaches: Combines proteomics, metabolomics, and transcriptomics to understand ATP synthase regulation in context

    • Metabolic flux analysis: Traces energy flow through the ATP synthase complex in living cells

    • In silico modeling: Creates predictive models of ATP synthase function under different environmental conditions

  • Environmental adaptation studies:

    • Comparative genomics: Analyzes ATP synthase adaptations across extremophiles from diverse environments

    • Directed evolution: Engineers ATP synthase to understand the molecular basis of adaptation to extreme conditions

    • Microfluidic cultivation: Enables precise control of environmental parameters to study ATP synthase function under varying conditions

  • Emerging technologies with potential applications:

    • CRISPR-based tracking: Monitors ATP synthase dynamics in living cells

    • Adaptive laboratory evolution: Explores functional plasticity of ATP synthase under selective pressure

    • Artificial intelligence approaches: Predicts structure-function relationships based on sequence data

These emerging techniques promise to address key questions, including:

  • How does ATP synthase from Alkaliphilus oremlandii maintain functionality under alkaline conditions?

  • What structural adaptations enable efficient energy conversion in extremophiles?

  • How do electron bifurcation processes in Alkaliphilus oremlandii potentially interact with ATP synthesis mechanisms?

The integration of these advanced approaches will likely provide unprecedented insights into the molecular mechanisms and evolutionary adaptations of ATP synthase in extremophiles like Alkaliphilus oremlandii .

How might understanding Alkaliphilus oremlandii ATP synthase contribute to broader research on bioenergetics and potential biotechnological applications?

Research on Alkaliphilus oremlandii ATP synthase has significant implications for fundamental bioenergetics and practical biotechnological applications:

  • Fundamental bioenergetic insights:

    • Ion coupling flexibility: Studies suggest that some ATP synthases can switch between using protons and sodium ions depending on environmental conditions. Understanding this mechanism in A. oremlandii could reveal fundamental principles of bioenergetic adaptation

    • Electron bifurcation connections: A. oremlandii contains electron bifurcation enzymes that may interact with energy conservation systems, potentially revealing novel energy coupling mechanisms

    • Extremophile adaptations: Insights into how ATP synthase functions under alkaline conditions may reveal general principles of protein adaptation to extreme environments

  • Biotechnological applications:

    • Biofuel production: Engineered ATP synthases could improve the efficiency of bioenergy processes by optimizing ATP production under industrial conditions

    • Biosensors: ATP synthase components could be developed into sensitive biosensors for detecting environmental toxins or monitoring cellular energy states

    • Protein engineering: Understanding the structural basis of ion specificity could enable the design of synthetic ATP synthases with novel properties

  • Biomedical relevance:

    • Antimicrobial targets: Differences between bacterial and human ATP synthases could be exploited for developing selective antimicrobials

    • Disease models: Insights into ATP synthase function may improve understanding of human mitochondrial disorders

    • Drug delivery systems: Reconstituted proteoliposomes containing ATP synthase components could potentially be developed into responsive drug delivery vehicles

  • Environmental applications:

    • Bioremediation: A. oremlandii's ability to reduce arsenate via energy conservation systems linked to ATP synthase might inform development of bioremediation strategies

    • Environmental monitoring: ATP synthase-based systems could be developed to detect environmental contaminants affecting bioenergetic processes

    • Climate adaptation: Understanding extremophile energy conservation may inform agricultural adaptations to changing climate conditions

Future research directions might include:

  • Comparative analysis of ATP synthase structure and function across diverse extremophiles

  • Development of synthetic biology applications utilizing engineered ATP synthase components

  • Integration of ATP synthase research with emerging fields like microbiome engineering and sustainable energy production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.