Recombinant Alkaliphilus oremlandii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Clos_1332; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs))
Target Names
mscL
Target Protein Sequence
MLEEFKKFALKGNVLDLAVGVIIGGAFGKIVTSLVNDIIMPILGLVVGGINFTALEYVLT EKGSEPIVLRYGQFIQTTFDFLIIAFSIFMFIKVLTKFKKKEEEKPASAPKPSKEEMLLS EIRDILKEKAN
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Alkaliphilus oremlandii and why is its MscL protein of interest to researchers?

Alkaliphilus oremlandii is a mesophilic, spore-forming, motile, low mole% GC gram-positive bacterium that was originally isolated from Ohio River sediments. It grows optimally at pH 8.4 and is a strict anaerobe with both fermentative and respiratory capabilities . The large-conductance mechanosensitive channel (MscL) from this organism is of particular interest because it functions as a pressure-relief valve during hypoosmotic shock, making it an ideal model system for investigating the molecular mechanisms of mechanical force transduction . The study of A. oremlandii MscL contributes to our broader understanding of mechanosensation, which underlies fundamental biological processes across all domains of life.

How does the MscL from A. oremlandii compare with MscL proteins from other bacterial species?

While the search results don't provide specific comparative data for A. oremlandii MscL, mechanosensitive channels in general share common structural features while exhibiting species-specific variations. MscL proteins typically function as pressure-relief valves during hypoosmotic shock, with highly conserved transmembrane domains and more variable cytoplasmic regions . The archaeal MscL proteins described in recent structural studies reveal coordinated movements between different domains during channel gating, providing insights into the mechanical coupling mechanisms that likely apply across species . For rigorous comparative studies, researchers should examine sequence homology, structural conservation, and functional similarities through expression systems that allow direct comparisons under identical experimental conditions.

What are the basic structural elements of the A. oremlandii MscL channel?

While the specific structure of A. oremlandii MscL has not been fully characterized in the provided search results, mechanosensitive channels typically share common architectural elements. Based on studies of archaeal MscL proteins, these channels demonstrate coordinated movements between different structural domains during conformational changes . The MscL proteins generally consist of multiple structural elements that undergo mechanical coupling during the force transduction process. The channel typically includes transmembrane domains that sense membrane tension, a pore region that opens to allow solute passage, and connecting elements that coordinate the transition between closed and open states . The mechanical coupling between these elements is critical for channel function, as revealed by comparative structural analysis of different conformational states.

What expression systems are most effective for producing recombinant A. oremlandii MscL?

Based on general principles for membrane protein expression, several systems could be suitable for A. oremlandii MscL production. E. coli expression systems using specialized strains (C41, C43, or Lemo21) with regulatable T7 promoters are commonly employed for membrane proteins. For recombinant expression, researchers should consider:

  • Vector selection: pET series vectors with a range of promoter strengths, allowing fine-tuned expression levels

  • Fusion tags: N-terminal His6 or His10 tags facilitate purification, while MBP or SUMO fusions may enhance solubility

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) over extended periods (16-24 hours) often improves functional yield

  • Media formulation: Use of specialized media such as Terrific Broth supplemented with glucose and trace metals

For anaerobic proteins like those from A. oremlandii, expression under microaerobic or anaerobic conditions may preserve native folding and function. Optimization should include systematic testing of expression parameters, with evaluation by Western blotting and activity assays to confirm proper folding and function.

What are the critical steps in purifying functional A. oremlandii MscL for structural and functional studies?

Purification of membrane proteins like MscL requires careful attention to maintaining the protein in a native-like environment. A general purification workflow would include:

  • Membrane isolation: Following cell lysis, differential centrifugation to isolate membrane fractions

  • Solubilization: Selection of appropriate detergents is critical - typically start with milder options like DDM, LMNG, or digitonin at concentrations 2-3× their CMC

  • Affinity chromatography: Using the introduced affinity tag (typically His-tag) with imidazole gradient elution

  • Size exclusion chromatography: To isolate homogeneous protein populations and remove aggregates

  • Reconstitution: Transfer from detergent to lipid environments (liposomes, nanodiscs) for functional studies

Critical considerations include maintaining an alkaline environment (pH ~8.4) to match the native conditions of A. oremlandii , and potentially including stabilizing agents like glycerol or specific lipids throughout the purification process. Each preparation should be assessed for homogeneity by SDS-PAGE and SEC-MALS, and for functionality through reconstitution and activity assays before proceeding to structural or biophysical studies.

How can researchers effectively study the conformational changes in A. oremlandii MscL during gating?

Studying conformational changes in mechanosensitive channels requires techniques that can capture dynamic structural transitions. Effective approaches include:

  • Cryo-electron microscopy: Capturing different conformational states by preparing samples under varying conditions, similar to the approach used for archaeal MscL that revealed coordinated domain movements

  • FRET-based methods: Strategic placement of fluorophore pairs to monitor distance changes during gating events

  • Site-directed spin labeling combined with EPR spectroscopy: To detect local environmental changes during conformational transitions

  • Molecular dynamics simulations: Using structural data as starting points to model the gating transitions under applied forces

  • Patch-clamp electrophysiology with simultaneous fluorescence imaging: To correlate structural changes with functional states

These approaches are most powerful when combined, allowing researchers to develop comprehensive models of how mechanical force is transduced through the channel structure. The recent comparative structural analysis of archaeal MscL in different conformational states provides a methodological template for such studies, revealing how multiple structural elements coordinate during the mechanical force transduction process .

What factors affect the pressure sensitivity of recombinant A. oremlandii MscL?

The pressure sensitivity of MscL channels is influenced by multiple factors:

  • Lipid environment: Membrane thickness, rigidity, and composition dramatically influence gating pressure thresholds

    • Shorter-chain lipids typically lower activation thresholds

    • Increased presence of negative curvature lipids (PE) can raise thresholds

    • Anionic lipids may alter threshold through electrostatic interactions

  • Protein modifications:

    • Specific amino acid substitutions at the pore constriction or tension-sensing interfaces

    • Post-translational modifications affecting hydrophobic interactions

  • Environmental factors:

    • pH conditions (particularly relevant for Alkaliphilus oremlandii, which thrives at pH 8.4)

    • Ionic strength and specific ion effects

    • Temperature

  • Protein-protein interactions:

    • Oligomeric state stability

    • Interactions with other membrane components

Researchers studying A. oremlandii MscL should systematically investigate these parameters through reconstitution into defined lipid systems combined with functional assays such as patch-clamp electrophysiology or fluorescence-based flux assays to establish structure-function relationships specific to this protein.

What electrophysiological methods are most suitable for characterizing A. oremlandii MscL function?

For electrophysiological characterization of recombinant A. oremlandii MscL, researchers should consider:

  • Patch-clamp techniques:

    • Excised patch configurations (inside-out or outside-out) allow precise control of membrane tension

    • Pressure clamp systems enable quantitative pressure-response relationships

    • Single-channel recordings provide detailed kinetic information about gating transitions

  • Planar lipid bilayer recordings:

    • Allow controlled lipid composition to study environmental effects

    • Enable studies under defined ionic conditions

    • Suitable for purified and reconstituted protein

  • Specialized protocols:

    • Pressure ramp protocols to determine activation thresholds

    • Voltage step protocols to assess voltage dependence (if any)

    • Multiple pressure applications to study adaptation or hysteresis

  • Data analysis approaches:

    • Dwell-time analysis for kinetic modeling

    • Noise analysis for estimating channel populations

    • Non-stationary fluctuation analysis for conductance estimates

When designing electrophysiological experiments, researchers should account for the alkaliphilic nature of A. oremlandii, potentially maintaining buffers at pH 8.4 to match its native environment . Correlation of functional data with structural studies is essential for developing comprehensive models of how mechanical force transduction occurs in this channel system.

How can liposome-based assays be optimized for studying A. oremlandii MscL function?

Liposome-based functional assays provide powerful tools for studying MscL channels in defined environments. For optimal results with A. oremlandii MscL:

  • Liposome preparation:

    • Select lipid compositions mimicking bacterial membranes (e.g., POPE:POPG mixtures)

    • Consider including native lipids extracted from A. oremlandii if available

    • Maintain pH at ~8.4 to match the optimal growth conditions of the source organism

    • Evaluate different proteoliposome formation methods (detergent dialysis, direct reconstitution, SEC)

  • Fluorescence-based assays:

    • Calcein de-quenching assays: Encapsulate self-quenching concentrations of calcein; MscL opening causes dye release and increased fluorescence

    • Stopped-flow measurements for kinetic analysis of channel opening

    • FRET-based approaches to monitor conformational changes

  • Experimental controls and quantification:

    • Include positive controls (liposomes with known MscL variants)

    • Negative controls (protein-free liposomes, inactive mutants)

    • Calibration with detergent to determine maximum possible release

  • Environmental stress application:

    • Osmotic downshock protocols with defined gradients

    • Direct mechanical stress through micropipette aspiration

    • Reconstitution onto curved surfaces (small liposomes)

What are common challenges in expressing and purifying functional A. oremlandii MscL, and how can they be addressed?

Researchers working with A. oremlandii MscL may encounter several challenges:

  • Expression challenges:

    • Low expression levels: Try reduced induction temperatures (16-20°C), codon-optimized sequences, and specialized expression strains

    • Toxicity to host cells: Use tightly regulated expression systems with lower basal expression

    • Inclusion body formation: Test fusion partners (MBP, SUMO) that enhance solubility

  • Purification obstacles:

    • Protein aggregation: Screen multiple detergents (start with DDM, LMNG, GDN) and include stabilizing agents

    • Loss of function during purification: Maintain consistent pH (~8.4) and include specific lipids throughout

    • Low purity: Implement additional purification steps (ion exchange, affinity tags at both termini)

  • Stability issues:

    • Limited thermal stability: Add glycerol (10-20%) and perform operations at 4°C

    • Time-dependent degradation: Include appropriate protease inhibitors and minimize purification duration

    • Oxidation sensitivity: Include reducing agents (DTT, TCEP) if the protein contains critical cysteine residues

  • Functional assessment:

    • Verification through multiple methods (electrophysiology, fluorescence assays)

    • Systematic optimization of reconstitution conditions

    • Comparison with well-characterized MscL homologs as positive controls

Maintaining the alkaliphilic conditions preferred by A. oremlandii throughout the workflow may prove critical for obtaining functionally active protein, as this organism grows optimally at pH 8.4 , and its proteins may have evolved stability features specific to this environment.

How can researchers address data inconsistencies when analyzing recombinant A. oremlandii MscL function?

When confronting inconsistent results in MscL functional studies, researchers should implement a systematic troubleshooting approach:

  • Evaluate protein quality:

    • Verify protein integrity through SDS-PAGE and mass spectrometry

    • Assess oligomeric state by native PAGE or SEC-MALS

    • Check for post-purification modifications that might affect function

  • Review experimental conditions:

    • Ensure consistent buffer compositions, especially pH (optimal at 8.4 for A. oremlandii proteins)

    • Standardize lipid compositions in reconstitution systems

    • Control temperature conditions precisely during measurements

  • Technical controls:

    • Include well-characterized MscL variants as benchmarks

    • Implement internal controls within each experiment

    • Blind analysis to minimize unconscious bias

  • Statistical approaches:

    • Increase biological replicates (different protein preparations)

    • Apply appropriate statistical tests with consideration of data distribution

    • Consider Bayesian analysis frameworks for complex datasets

  • Cross-validation strategies:

    • Verify findings using complementary methodologies

    • Compare results from multiple functional assays

    • Validate key findings through collaborations with independent laboratories

Systematically documenting all experimental variables in a comprehensive laboratory information management system helps identify subtle factors that might contribute to inconsistent results, facilitating standardization and reproducibility across different experimental sessions.

How might the extremophilic adaptations of A. oremlandii influence the functional properties of its MscL channel?

A. oremlandii's alkaliphilic nature likely shapes the functional characteristics of its MscL channel in several important ways:

  • Structural adaptations:

    • Modified surface charge distribution to maintain stability at pH 8.4

    • Potentially altered hydrophobic interactions in the transmembrane domains

    • Adapted interfacial regions to accommodate the distinct membrane composition of alkaliphiles

  • Functional consequences:

    • Potentially shifted gating thresholds compared to neutrophilic bacteria

    • Different ion conductance properties or selectivity at elevated pH

    • Modified kinetics of opening and closing transitions

  • Research approaches to investigate these adaptations:

    • Comparative studies across MscL homologs from bacteria with different pH optima

    • Structure-function analysis focusing on residues unique to A. oremlandii MscL

    • Systematic characterization at varying pH conditions to establish pH-activity profiles

  • Evolutionary significance:

    • Understanding how mechanosensitive channels adapt to extreme environments

    • Insights into convergent evolution of mechanoprotection strategies

    • Clues to the fundamental principles governing mechanotransduction across diverse conditions

This research direction not only enhances our understanding of this specific protein but contributes to the broader knowledge of how mechanical sensing mechanisms adapt to environmental extremes across the tree of life.

What insights can the study of A. oremlandii MscL provide about the mechanical coupling mechanisms in mechanosensitive channels?

Investigating the mechanical coupling in A. oremlandii MscL can provide valuable insights into fundamental principles of mechanotransduction:

  • Comparative structural analysis:

    • Similar to studies with archaeal MscL that revealed coordinated domain movements

    • Identification of key interfaces between structural elements

    • Mapping of the force transmission pathways through the protein complex

  • Critical research questions:

    • How are forces from the membrane transmitted to the channel gate?

    • What structural elements coordinate during different phases of the gating transition?

    • How do oligomeric interactions contribute to cooperative gating behavior?

  • Experimental approaches:

    • Cryo-EM structures in different conformational states

    • Site-directed mutagenesis targeting predicted coupling interfaces

    • Computational simulations of force propagation pathways

  • Potential unique features:

    • Adaptations specific to the alkaliphilic lifestyle of A. oremlandii

    • Distinctive coupling mechanisms evolved for its native membrane environment

    • Potentially specialized features related to its anaerobic metabolism

The mechanical coupling mechanisms revealed through such studies contribute to our understanding of mechanosensation as a fundamental biological process, with implications for mechanobiology across all domains of life, from microbes responding to osmotic challenges to complex sensory systems in multicellular organisms .

What is the relationship between the dimerization behavior observed in other A. oremlandii proteins and potential oligomerization dynamics in its MscL?

While the search results don't directly address MscL oligomerization, they do mention interesting dimerization behavior in another A. oremlandii protein, MsrA, which may provide relevant insights:

  • Comparative analysis of oligomerization mechanisms:

    • A. oremlandii MsrA undergoes homodimerization during catalysis through intermolecular disulfide bonds between catalytic Cys16 residues

    • This dimerization is substrate-dependent and concentration/time-dependent

    • Similar redox-dependent oligomerization dynamics could potentially exist in A. oremlandii MscL

  • Structural features of interest:

    • The dimeric MsrA forms a central cone-shaped hole with catalytic residues at its base

    • This architecture could represent a common structural motif in A. oremlandii proteins

    • Potential shared evolutionary adaptations for protein-protein interfaces

  • Research questions to explore:

    • Does A. oremlandii MscL exhibit unique oligomerization dynamics compared to homologs?

    • Are there conserved dimerization/oligomerization motifs across different A. oremlandii proteins?

    • How might redox conditions affect MscL assembly and function in this organism?

  • Methodological approaches:

    • Crosslinking studies under various conditions

    • Native mass spectrometry to capture oligomeric states

    • Mutational analysis of potential interface residues

Understanding whether similar dimerization mechanisms exist across different proteins from the same organism could reveal organism-specific adaptations in protein-protein interactions that have evolved in response to A. oremlandii's unique ecological niche.

How can computational modeling enhance our understanding of A. oremlandii MscL gating mechanisms?

Computational approaches offer powerful tools for investigating mechanosensitive channel dynamics:

  • Molecular dynamics (MD) simulations:

    • All-atom simulations to model conformational changes during gating

    • Coarse-grained approaches for longer timescale events

    • Targeted MD with applied forces to simulate membrane tension

  • Specialized computational techniques:

    • Normal mode analysis to identify collective motions

    • Elastic network models to map mechanical coupling pathways

    • Free energy calculations to determine energy landscapes of gating transitions

  • Integration with experimental data:

    • Structure-based models informed by cryo-EM or X-ray crystallography

    • Validation of simulation predictions through mutagenesis and functional assays

    • Refinement of computational parameters based on experimental feedback

The mechanical coupling between multiple structural elements of MscL, as observed in archaeal homologs , provides an excellent target for computational investigation. Models should account for A. oremlandii's alkaliphilic nature, potentially incorporating its optimal pH (8.4) into simulation parameters to accurately reflect the native environment of this protein.

What are promising research directions for studying the relationship between A. oremlandii MscL and other stress response mechanisms in this extremophile?

Future research investigating A. oremlandii MscL in the context of broader stress responses holds significant potential:

  • Integration with redox systems:

    • A. oremlandii has arsenate reductase capabilities suggesting sophisticated redox management

    • Potential cross-talk between mechanical stress sensing and redox signaling

    • Investigation of how MscL function might be modulated by redox conditions

  • Anaerobic stress adaptations:

    • As a strict anaerobe , A. oremlandii requires specialized stress management

    • Comparison of MscL function under varying oxygen exposure

    • Potential specialized features for osmotic management in anaerobic environments

  • Multi-stress response networks:

    • Transcriptomic studies to identify co-regulated genes under osmotic stress

    • Proteomic analysis of interaction partners with MscL under stress conditions

    • Metabolomic profiling during osmotic challenges to identify protective solutes

  • Comparative studies across extremophiles:

    • Functional comparison with MscL from other alkaliphiles

    • Evolutionary analysis of mechanosensitive systems in diverse extremophiles

    • Identification of convergent adaptations in mechanosensation across different extreme environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.