Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882 (Clos_0882)

Shipped with Ice Packs
In Stock

Description

Functional Role

Clos_0882 is annotated as a putative manganese efflux pump (MntP) based on gene homology and functional predictions . Key functional insights include:

  • Metal Ion Transport: Likely regulates manganese homeostasis, preventing cellular toxicity via efflux .

  • Operon Context: The mntP gene is part of a conserved operon linked to metal resistance in anaerobic bacteria .

  • Respiratory Capability: Alkaliphilus oremlandii exhibits respiratory versatility, but Clos_0882’s direct role in arsenic or sulfur metabolism remains unconfirmed .

Biochemical Studies

  • Structural Modeling: Computational analyses suggest Clos_0882 shares topological similarities with ion-coupled transporters, such as Vc-NhaP2, a sodium-proton antiporter .

  • Interaction Dynamics: Experimental studies on analogous membrane proteins reveal subdiffusive motion and transient oligomerization within lipid bilayers .

Industrial Relevance

  • Antimicrobial Targets: Membrane transporters like Clos_0882 are explored as targets for disrupting bacterial metal homeostasis .

  • Protein Engineering: The recombinant form serves as a template for mutational studies to dissect ion selectivity and transport mechanisms .

Production and Handling

Recombinant Clos_0882 is lyophilized for stability and requires reconstitution in deionized water (0.1–1.0 mg/mL). Key protocols include:

  • Reconstitution: Addition of 5–50% glycerol for long-term storage at -80°C .

  • Avoidance of Freeze-Thaw Cycles: Aliquotting is critical to preserve activity .

Future Directions

Current gaps include resolving its atomic-resolution structure and validating its manganese transport activity in vitro. Studies leveraging cryo-EM or X-ray crystallography could elucidate its mechanism, while heterologous expression in metal-sensitive strains may confirm physiological roles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mntP; Clos_0882; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs))
Target Names
mntP
Target Protein Sequence
MGLIELTFIAVALSMDAFAAAICKGLCMKKNALKNTIIVGIFFGGFQAIMPLIGYILGTQ FNESISSIDHWIAFILLSIIGINMIRESREDDCSCDVDYSDSSFGMKNMTLLALATSIDA LAVGVTFAFLKVKIAPAIGIIGAITFILSIIGVKIGTVFGMKYKSKAEIAGGVILITMGA KILLEHLL
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882?

Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882 is a membrane protein derived from the bacterium Alkaliphilus oremlandii (strain OhILAs), also referred to as Clostridium oremlandii (strain OhILAs). This protein belongs to the MntP (TC 9.B.29) family and functions as a putative manganese efflux pump . The recombinant version contains a full-length protein (amino acids 1-188) with a molecular weight of approximately 20,048 Da . In research contexts, it is typically produced with an N-terminal tag and may also include a C-terminal tag, depending on stability requirements and experimental needs .

What is the known or predicted function of UPF0059 membrane protein Clos_0882?

Based on sequence similarities and protein family classification, Clos_0882 is believed to function as a manganese efflux pump (MntP) . Manganese efflux pumps play crucial roles in maintaining intracellular metal homeostasis by exporting excess manganese ions, which can be toxic at high concentrations. While the exact mechanism of action for Clos_0882 specifically has not been extensively characterized, proteins in the MntP family typically span the cell membrane multiple times (multi-pass membrane proteins) and utilize ion gradients or other energy sources to facilitate the transport of manganese ions against concentration gradients . Further functional studies are needed to fully elucidate its specific transport mechanisms, regulatory factors, and physiological relevance in Alkaliphilus oremlandii.

What expression systems are optimal for producing Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882?

Multiple expression systems can be used to produce Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Use Case
E. coliHigher yields, shorter turnaround time, cost-effectiveLimited post-translational modificationsInitial structural studies, antibody production
YeastGood yields, moderate turnaround time, some eukaryotic PTMsLess efficient than E. coli for some proteinsFunctional studies requiring some PTMs
Insect cellsBetter post-translational modificationsLonger production time, higher costDetailed functional studies
Mammalian cellsOptimal post-translational modifications, proper foldingLowest yields, highest cost, longest timeActivity assays requiring native-like protein

What are the recommended storage conditions for maintaining stability of Clos_0882?

To maintain the stability and activity of Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C or -80°C for extended periods .

  • Buffer composition: Tris-based buffer containing 50% glycerol, optimized for this specific protein .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw considerations: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of functional activity .

For experimental work requiring regular use of the protein, it is advisable to prepare small working aliquots to minimize repeated freeze-thaw cycles. The specific buffer composition may be further optimized based on the particular experimental requirements, such as pH considerations for activity assays or compatibility with downstream applications.

What experimental designs are optimal for studying membrane proteins like Clos_0882?

When designing experiments to study membrane proteins like Clos_0882, researchers should consider several key principles:

  • Factorial Design Approach: Implement factorial designs to systematically explore multiple variables affecting protein function or expression simultaneously. This approach is particularly valuable for membrane proteins where multiple factors interact to influence stability and activity .

  • Closed-Loop vs. Open-Loop Considerations: Many industrial processes operate under closed-loop control, which can mask the effects of experimental factors. When designing experiments with membrane proteins in bioreactors or continuous flow systems, consider whether closed-loop control mechanisms might interfere with observing the true effects of your experimental variables .

  • D-Optimal Design for Dose-Response Studies: When examining how membrane transporters like Clos_0882 respond to substrate concentrations or inhibitors, D-optimal designs can maximize information while minimizing experiment size. Research suggests using four carefully selected concentration levels (typically including the control, two intermediate levels, and the maximum concentration) with equal weight (0.25) given to each level .

  • Anchored Experimental Design for Cross-Study Comparisons: When conducting multiple studies of Clos_0882 over time, implement an anchored experimental design with consistent control samples across studies. This approach enables integration of data from separate experiments while minimizing batch effects .

  • Tool for Interrelated Experimental Design (TIED): Consider using assessment tools like TIED that examine the interrelatedness of experimental components. This ensures that your data collection methods align properly with your hypothesis and that observations can actually be derived from your proposed data collection methods .

For optimal results, design your experiments to include appropriate controls, sufficient replicates, and randomization while maintaining the interrelatedness of different experimental components.

How can batch effects be minimized when working with recombinant membrane proteins?

Batch effects can significantly impact experimental results when working with recombinant membrane proteins like Clos_0882. To minimize these effects, consider implementing the following strategies:

  • Anchored Experimental Design: Include consistent control samples across all experimental batches to serve as anchors for normalization and integration . For example, include a standard reference preparation of Clos_0882 with known activity in each batch.

  • Extraction Batch Organization: When extracting membrane proteins:

    • Limit batch sizes based on equipment capacity (e.g., centrifuge capacity)

    • Include appropriate controls in each batch (extraction blanks, biological replicates)

    • Plan extraction batches to ensure balanced distribution of test conditions

  • Block Design Implementation: Organize experiments into blocks where all conditions to be directly compared are processed within the same experimental unit to reduce the impact of day-to-day or batch-to-batch variation .

  • Quality Control Measures: Implement consistent quality control checks across batches, such as:

    • Monitoring protein purity via SDS-PAGE

    • Tracking yields across batches

    • Including internal batch adjustment standards (IBAT controls)

  • Meta-analysis Approach: When combining data from multiple experiments with Clos_0882, use meta-analysis techniques that explicitly account for batch as a variable in statistical models .

  • Consistent Experimental Conditions: Maintain consistency in:

    • Expression systems and culture conditions

    • Purification protocols and buffer compositions

    • Storage conditions and handling procedures

For example, when designing a multi-batch experiment with Clos_0882, plan to distribute biological replicates across different batches while ensuring that key comparative conditions appear within the same batch. This balanced incomplete block design approach allows for both within-batch direct comparisons and cross-batch normalization .

What considerations are important for tag selection when expressing Clos_0882?

The selection of tags for Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882 requires careful consideration of multiple factors:

  • Tag-Protein Stability: Different tags can significantly impact the stability of membrane proteins. For Clos_0882, tag selection should be informed by stability analyses to ensure the tag doesn't interfere with protein folding or membrane insertion .

  • Position of Tags: Consider whether N-terminal, C-terminal, or both tags are appropriate:

    • N-terminal tags may be preferred if the C-terminus is critical for function

    • C-terminal tags may be better if the N-terminus is involved in membrane insertion

    • For Clos_0882, an N-terminal tag is commonly used, with the potential addition of a C-terminal tag based on specific experimental needs

  • Tag Size and Properties: Consider how tag properties will affect:

    • Protein solubility and expression efficiency

    • Membrane insertion and topology

    • Downstream purification strategies

    • Potential interference with functional assays

  • Cleavage Options: Include protease cleavage sites between the tag and protein if native protein is required for downstream applications.

  • Purification Strategy Compatibility: Select tags that align with your purification approach, considering:

    • Affinity tags for specific purification methods (His, GST, MBP, etc.)

    • Tag removal requirements for functional studies

    • Buffer compatibility throughout the purification process

  • Detection Requirements: Consider tags that facilitate detection in various assays:

    • Fluorescent protein fusions for localization studies

    • Epitope tags for immunodetection

    • Enzymatic tags for activity-based detection

The specific tag choice should be determined during the production process based on testing multiple constructs to optimize for the particular research application . For initial characterization, affinity tags that enable efficient purification while minimizing impact on protein structure and function are generally preferred.

What methods can be used to assess the membrane integration and topology of Clos_0882?

Determining the membrane integration and topology of Clos_0882 requires a multi-faceted experimental approach:

  • Computational Prediction Tools:

    • Begin with transmembrane domain prediction software (TMHMM, HMMTOP, Phobius)

    • Apply topology prediction algorithms specific to transporters

    • Generate consensus models from multiple prediction methods

  • Biochemical Approaches:

    • Protease Protection Assays: Expose membrane preparations containing Clos_0882 to proteases; domains exposed to the external environment will be digested while transmembrane and internal domains are protected

    • Chemical Labeling: Use membrane-impermeable labeling reagents to identify exposed regions

    • Glycosylation Mapping: Introduce glycosylation sites at various positions to determine lumenal exposure

  • Spectroscopic Methods:

    • FTIR Spectroscopy: Assess secondary structure elements within the membrane

    • Fluorescence Spectroscopy: Introduce fluorescent probes at specific positions to determine membrane proximity

    • EPR Spectroscopy: Use spin-labeled variants to determine distances and accessibility

  • Structural Biology Approaches:

    • Cryo-electron Microscopy: For high-resolution structural determination

    • X-ray Crystallography: If the protein can be crystallized

    • NMR Spectroscopy: For dynamic structural information

  • Genetic Fusion Approaches:

    • Reporter Fusion Analysis: Create fusions with reporters like alkaline phosphatase or GFP at different positions

    • Split-protein Complementation: Use split reporter systems to determine topology

When implementing these methods, consider using an experimental design that tests multiple positions along the protein sequence systematically. This comprehensive approach will provide complementary data from different techniques to build a robust topology model of Clos_0882 within the membrane.

How can researchers optimize the purification of Clos_0882 to maintain functional integrity?

Optimizing the purification of Clos_0882 while maintaining its functional integrity requires careful consideration of multiple parameters:

  • Detergent Selection and Optimization:

    • Initial Screening: Test a panel of detergents (mild non-ionic, zwitterionic, etc.) for extraction efficiency

    • Stability Assessment: Monitor protein stability in different detergents over time

    • Functional Assays: Determine which detergents preserve functional activity

    • Recommended Approach: Begin with a systematic screening of detergents using a factorial design to identify optimal extraction conditions

  • Buffer Optimization:

    • pH Range: Test stability across physiologically relevant pH range (typically pH 6.5-8.0)

    • Salt Concentration: Optimize ionic strength to maintain protein stability

    • Additives: Evaluate stabilizing additives like glycerol (typically 50% as indicated for Clos_0882) , specific lipids, or metal ions

  • Purification Strategy Development:

    Purification StepConsiderationsCritical Parameters
    Cell LysisGentle methods to prevent denaturationTemperature, mechanical force
    Membrane IsolationDifferential centrifugationCentrifugation speed, buffer composition
    SolubilizationOptimal detergent:protein ratioDetergent concentration, incubation time
    Affinity PurificationTag accessibility, binding conditionsFlow rate, binding/elution buffers
    Size ExclusionSeparation from aggregatesColumn selection, flow rate
    Quality ControlPurity assessment (≥85% by SDS-PAGE) Storage conditions, stability testing
  • Reconstitution Considerations:

    • Lipid Composition: Test various lipid compositions that mimic the native membrane

    • Reconstitution Method: Compare detergent dialysis, direct dilution, and liposome fusion

    • Functional Verification: Confirm activity after reconstitution

  • Stability Monitoring During Purification:

    • Thermal Stability Assays: Monitor unfolding using techniques like differential scanning fluorimetry

    • Batch Effects Minimization: Implement consistent protocols and include internal standards

    • Activity Assays: Track functional activity at each purification stage

The optimal purification strategy should be determined empirically through systematic testing of conditions, with a focus on maintaining the native-like environment for this membrane protein throughout the purification process.

What experimental approaches can be used to study manganese transport by Clos_0882?

As a putative manganese efflux pump , studying the transport activity of Clos_0882 requires specialized experimental approaches:

  • In Vitro Transport Assays:

    • Liposome Reconstitution: Incorporate purified Clos_0882 into liposomes with defined lipid composition

    • Radioisotope Flux Measurements: Use ⁵⁴Mn to directly measure transport kinetics

    • Fluorescent Probes: Employ manganese-sensitive fluorophores to monitor transport in real-time

    • Isothermal Titration Calorimetry (ITC): Determine binding affinity and stoichiometry of manganese interaction

  • Cellular Transport Systems:

    • Heterologous Expression: Express Clos_0882 in manganese-sensitive model organisms

    • Metal Sensitivity Assays: Compare growth in varying manganese concentrations

    • Intracellular Metal Quantification: Use inductively coupled plasma mass spectrometry (ICP-MS) to measure cellular manganese content

    • Complementation Studies: Test functional complementation in strains lacking endogenous manganese efflux systems

  • Structure-Function Analysis:

    • Site-Directed Mutagenesis: Target conserved residues predicted to be involved in transport

    • Chimeric Proteins: Create chimeras with other characterized MntP family members

    • Truncation Analysis: Determine essential regions for transport activity

    • Experimental Design Considerations: Implement D-optimal designs for dose-response studies of transport activity

  • Advanced Biophysical Approaches:

    • Electrophysiology: Measure transport-associated currents in planar lipid bilayers

    • Solid-State NMR: Examine conformational changes upon manganese binding

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Identify regions undergoing conformational changes during transport

  • Optimal Experimental Design Implementation:

    • Factorial Approach: Systematically vary multiple parameters (pH, membrane potential, manganese concentration)

    • Response Surface Methodology: Determine optimal conditions for transport activity

    • Consistent Controls: Implement anchored experimental design with appropriate controls

    • Interrelated Design Elements: Ensure alignment between hypothesis, experimental variables, and data collection methods

When investigating manganese transport, it's crucial to control for confounding variables such as other metal ions, membrane integrity, and protein orientation in reconstituted systems. The experimental approach should be tailored to answer specific questions about transport mechanism, substrate specificity, energetics, and regulation of Clos_0882 activity.

How does Clos_0882 compare to other MntP family proteins structurally and functionally?

Clos_0882 belongs to the MntP (TC 9.B.29) family of manganese transporters , and comparative analysis reveals important insights about its potential structure and function:

  • Sequence Conservation Analysis:

    • MntP family proteins typically contain multiple transmembrane domains

    • Key residues involved in manganese coordination are generally conserved

    • Clos_0882 maintains the characteristic sequence motifs of the MntP family

    • Phylogenetic analysis can reveal evolutionary relationships and potential functional divergence

  • Structural Comparison:

    ProteinOrganismStructural FeaturesFunctional DifferencesSimilarity to Clos_0882
    MntPE. coli4 transmembrane domainsWell-characterized Mn²⁺ effluxModerate sequence similarity
    CE1598C. elegansSimilar membrane topologyEukaryotic regulatory mechanismsLimited functional data available
    YebNSalmonella speciesHighly conserved among enterobacteriaRole in pathogenesisFunctional conservation likely
  • Functional Mechanism Comparison:

    • Most MntP family proteins function as secondary active transporters

    • They typically utilize ion gradients rather than ATP hydrolysis

    • Transport kinetics vary among family members (Km, Vmax)

    • Substrate specificity may extend beyond manganese in some homologs

  • Expression and Regulation Patterns:

    • MntP expression is typically regulated by manganese levels

    • Regulatory mechanisms vary between bacterial species

    • Promoter analysis can reveal potential regulatory elements

    • Experimental design considerations should account for expression regulation

  • Physiological Role Variations:

    • Role in metal homeostasis across different bacterial species

    • Contribution to stress responses and survival

    • Potential involvement in pathogenesis for some family members

    • Environmental adaptation functions in extremophiles like Alkaliphilus oremlandii

When designing comparative studies, researchers should implement experimental approaches that account for the membrane protein nature of these transporters, using the anchored experimental design methodology to enable valid cross-species comparisons .

What are the current research gaps and future directions for studying Clos_0882?

Despite available information about UPF0059 membrane protein Clos_0882, several significant research gaps remain that represent important future research directions:

  • Structural Characterization:

    • High-resolution structural determination has not been reported

    • Detailed understanding of the transport channel architecture is lacking

    • Conformational changes during transport cycle remain uncharacterized

    • Research Direction: Apply cryo-EM or X-ray crystallography techniques optimized for membrane proteins

  • Transport Mechanism:

    • Precise manganese binding sites have not been identified

    • Energy coupling mechanism remains speculative

    • Transport stoichiometry is unknown

    • Research Direction: Combine site-directed mutagenesis with transport assays using optimal experimental design principles

  • Physiological Role:

    • Function in Alkaliphilus oremlandii biology is presumptive

    • Contribution to manganese homeostasis needs experimental validation

    • Role in stress responses and environmental adaptation is unexplored

    • Research Direction: Develop knockout/complementation systems and stress response assays

  • Regulatory Networks:

    • Transcriptional and post-translational regulation is poorly understood

    • Environmental signals affecting expression are unknown

    • Protein-protein interactions remain unexplored

    • Research Direction: Apply systems biology approaches with anchored experimental design

  • Evolutionary Context:

    • Selective pressures driving MntP evolution are unclear

    • Functional divergence among homologs needs characterization

    • Taxonomic distribution patterns require explanation

    • Research Direction: Conduct comparative genomics and experimental evolution studies

  • Biotechnological Applications:

    • Potential for metal bioremediation applications is unexplored

    • Engineering possibilities for altered metal specificity

    • Use as a model system for membrane protein expression optimization

    • Research Direction: Apply principles from industrial experimental design to optimization efforts

To address these gaps, researchers should design comprehensive experimental approaches that combine structural, functional, and systems-level analyses. Implementation of optimal experimental design principles, including factorial approaches for multiple variables and proper control of batch effects , will be crucial for generating reliable and interpretable results in these complex systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.