Recombinant Pseudomonas oleovorans Alkane 1-monooxygenase (alkB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant AlkB is a 401-amino acid membrane-bound diiron monooxygenase encoded by the alkB gene (UniProt ID: P12691) from Pseudomonas oleovorans . Key characteristics include:

PropertySpecification
HostEscherichia coli
TagN-terminal His tag
Molecular Weight~46 kDa (calculated)
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer + 6% trehalose
ApplicationsEnzyme kinetics, structural studies, SDS-PAGE analysis

The enzyme catalyzes the initial hydroxylation of alkanes to alcohols, requiring electron transfer partners (rubredoxin and NADH-dependent reductase) .

Gene Organization and Regulation

The alkB gene resides within the alkBFGHJKL operon on the OCT plasmid of P. oleovorans. Key regulatory features:

  • Induction: Activated by alkanes via the transcriptional regulator AlkS .

  • Promoter: PalkB is repressed by preferred carbon sources (e.g., glucose) through catabolite repression .

  • Operon Structure: Includes genes for alkane hydroxylase (alkB), rubredoxin (alkG), alcohol dehydrogenase (alkJ), and aldehyde dehydrogenase (alkH) .

Expression in Heterologous Hosts

  • High-Yield Production: In E. coli W3110, AlkB constitutes 10–15% of total cellular protein, far exceeding levels in P. oleovorans .

  • Physiological Impact: Overexpression alters membrane lipid composition and induces filamentation in both E. coli and Pseudomonas hosts .

Functional Insights

  • Membrane Localization: AlkB integrates into the cytoplasmic membrane, requiring phospholipid synthesis for stability .

  • Electron Transfer: Relies on rubredoxin (AlkG) and reductase (AlkT) for catalytic activity .

Instability and Adaptation

  • Gene Inactivation: Prolonged induction (>10 generations) leads to alkB inactivation in P. oleovorans, restoring normal growth rates .

  • Carbon Source Effects: Glycerol enhances PalkB activity, while glucose suppresses it via catabolite repression .

Biotechnological Applications

  • Biotransformations: Used in enantioselective epoxidation of alkenes and terminal oxidation of alkanes .

  • Bioremediation: Degrades petroleum hydrocarbons in contaminated environments .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference for your own formulations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles to preserve protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it based on your specification.
Synonyms
alkB; Alkane 1-monooxygenase; Alkane hydroxylase; AHs; Terminal alkane hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Pseudomonas oleovorans
Target Names
alkB
Target Protein Sequence
MLEKHRVLDSAPEYVDKKKYLWILSTLWPATPMIGIWLANETGWGIFYGLVLLVWYGALP LLDAMFGEDFNNPPEEVVPKLEKERYYRVLTYLTVPMHYAALIVSAWWVGTQPMSWLEIG ALALSLGIVNGLALNTGHELGHKKETFDRWMAKIVLAVVGYGHFFIEHNKGHHRDVATPM DPATSRMGESIYKFSIREIPGAFIRAWGLEEQRLSRRGQSVWSFDNEILQPMIITVILYA VLLALFGPKMLVFLPIQMAFGWWQLTSANYIEHYGLLRQKMEDGRYEHQKPHHSWNSNHI VSNLVLFHLQRHSDHHAHPTRSYQSLRDFPGLPALPTGYPGAFLMAMIPQWFRSVMDPKV VDWAGGDLNKIQIDDSMRETYLKKFGTSSAGHSSSTSAVAS
Uniprot No.

Target Background

Function
This enzyme catalyzes the hydroxylation of n-alkanes and fatty acids in the presence of NADH-rubredoxin reductase and rubredoxin.
Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of alkB in Pseudomonas oleovorans?

The alk genes of Pseudomonas oleovorans are organized into two main clusters: alkST and alkBFGHJKL. The expression of the alkBFGHJKL operon is positively regulated by AlkS, which functions as a transcriptional activator. This genetic organization is critical for the coordinated expression of alkane degradation enzymes. The alkB gene specifically encodes the Alkane 1-monooxygenase, a key enzyme that initiates alkane oxidation in the degradation pathway .

How does AlkB function within bacterial alkane degradation pathways?

AlkB functions as a membrane-bound monooxygenase that catalyzes the initial hydroxylation of alkanes to produce primary alcohols. This is the first and rate-limiting step in the alkane degradation pathway. The enzyme incorporates one atom of molecular oxygen into the alkane substrate while reducing the other oxygen atom to water, requiring reducing equivalents typically provided by rubredoxin. After the initial hydroxylation by AlkB, the resulting alcohol is further oxidized by alcohol and aldehyde dehydrogenases to produce fatty acids that can enter central metabolism .

What plasmid systems are commonly used for expressing recombinant alkB?

The plasmid pGEc47 is one of the most widely studied systems for regulated expression of alkB and synthesis of active AlkB in recombinant organisms such as Escherichia coli. This plasmid contains the necessary regulatory elements for controlled expression of the alkB gene. Researchers have successfully used this system in E. coli strains like HB101 and W3110, with W3110 (pGEc47) demonstrating approximately five times higher AlkB production than P. oleovorans itself. The choice of plasmid system significantly impacts the expression levels and stability of the recombinant protein .

How should researchers design experiments to study alkB expression and activity?

When designing experiments to study alkB expression and activity, researchers should follow a systematic approach:

  • Define clear variables (independent and dependent) related to alkB expression

  • Formulate a specific, testable hypothesis about alkB function or regulation

  • Design experimental treatments to manipulate the independent variable (e.g., inducer concentration)

  • Determine appropriate control groups

  • Plan precise measurements of your dependent variable (e.g., protein expression levels or enzymatic activity)

What approaches can be used to detect and quantify alkB gene diversity in bacterial communities?

To effectively detect and quantify alkB gene diversity in bacterial communities, researchers should implement a combined primer approach rather than relying on a single primer set. This strategy significantly improves the detection of alkB diversity due to the wide variation in alkB nucleotide sequences among different bacterial strains. A combination of three different alkB-targeting primers has been shown to enhance detection of the alkB gene in previously isolated alkane-degrading bacteria, with successful amplification in 79% of tested strains .

The following table shows commonly used alkB-targeting primer combinations that can significantly improve detection:

Primer codealkB-targeting primersPrimer sequencesApproximate position of alkB fragments
(a)RHOSE5′ ACG GSC AYT TCT ACR TCG 3′481 to 823 nt
RHOAS5′ CCG TAA RTG YTC GAG RTA G 3′
(b)Rh alkB1-F25′ AT C TGG GCG CGT TGG GAT TTG AGC G 3′331 to 950 nt
Rh alkB1-R15′ CG C ATG GTG ATC GCT GTG CCG CTG C 3′
(c)Rh alkB2-F25′ AC T TTG GCG CAG TCG TTT TAC GGC C 3′462 to 1013 nt

Using this combinatorial approach can enhance the richness of alkB phylotypes detected by 45% to 139% compared to using a single primer set .

What methods are effective for studying alkB gene expression regulation?

Effective methods for studying alkB gene expression regulation include:

  • Reporter gene assays: Fusing the alkB promoter region to reporter genes like lacZ or gfp to monitor transcriptional activity

  • RT-qPCR: Quantifying alkB mRNA levels under different conditions

  • Proteomics: Using mass spectrometry or immunoblotting to measure AlkB protein levels

  • Chromatin immunoprecipitation (ChIP): Identifying protein-DNA interactions at the alkB promoter

  • Inducer studies: Using gratuitous inducers like dicyclopropylketone to activate the alk system without substrate metabolism

These methods can be combined to comprehensively understand the complex regulation of alkB expression. When studying the AlkS-mediated regulation of alkB, researchers should consider both transcriptional and post-transcriptional regulatory mechanisms .

How do expression levels of recombinant AlkB differ between host systems?

Expression levels of recombinant AlkB show significant variation between different host systems. Studies comparing P. oleovorans with recombinant E. coli strains have revealed important differences:

  • P. oleovorans (wild-type): Produces AlkB at approximately 1.5-2% of total cell protein

  • E. coli HB101 (pGEc47): Produces similar amounts of AlkB as P. oleovorans (1.5-2% of total cell protein)

  • E. coli W3110 (pGEc47): Produces approximately five times more AlkB than P. oleovorans

These differences in expression levels have significant implications for recombinant protein production strategies. The choice of host system should be based on the research objectives, as higher expression levels may not always be advantageous due to potential physiological impacts on host cells .

What strategies can optimize alkB expression while minimizing physiological stress on host cells?

To optimize alkB expression while minimizing physiological stress on host cells, researchers should consider the following strategies:

  • Use inducible promoter systems with tight regulation to control expression levels

  • Optimize induction conditions (inducer concentration, timing, temperature)

  • Consider co-expression of chaperones or other factors that may stabilize AlkB

  • Balance expression levels with physiological impacts (higher expression isn't always better)

  • Use host strains with enhanced membrane protein expression capabilities

  • Implement fed-batch or continuous cultivation strategies to minimize metabolic burden

These strategies are particularly important given that excessive alkB expression has been shown to cause physiological stress and morphological changes in host cells, including reduced growth rates and filamentation. Finding the optimal balance between expression levels and host cell health is crucial for successful recombinant AlkB production .

How can researchers measure and compare AlkB synthesis and degradation rates?

Researchers can measure and compare AlkB synthesis and degradation rates using isotopic-labeling and immunological techniques:

  • Pulse-chase experiments: Label cells with radioactive amino acids for a brief period (pulse), then follow with non-radioactive amino acids (chase) to track protein synthesis and degradation over time

  • Immunological detection: Use AlkB-specific antibodies for Western blotting or ELISA to quantify protein levels

  • Mass spectrometry: Apply stable isotope labeling (SILAC) to track protein turnover rates

  • Protein synthesis inhibitors: Use antibiotics like chloramphenicol to block new protein synthesis and measure degradation rates

  • Mathematical modeling: Apply kinetic models to calculate synthesis and degradation rate constants

These approaches have been successfully used to determine AlkB synthesis and degradation rates in batch cultures of P. oleovorans and recombinant E. coli strains, providing valuable insights into AlkB protein dynamics under various growth conditions .

How does recombinant alkB expression affect host cell physiology and morphology?

Recombinant alkB expression has several significant effects on host cell physiology and morphology:

  • Reduced growth rates: Cells expressing alkB typically grow slower than non-expressing controls

  • Filamentation: Cells can form elongated filaments rather than dividing normally, resulting in reduced CFU counts

  • Membrane alterations: Expression of membrane-bound AlkB can modify membrane composition and integrity

  • Metabolic burden: Resources diverted to alkB expression may affect other cellular processes

  • Stress responses: Cells may activate stress response pathways to cope with physiological changes

These effects are observed not only during growth on alkane substrates but also when cells are grown on aqueous medium with the alk genes induced by gratuitous inducers like dicyclopropylketone. The physiological impacts appear to be related to the expression of multiple alk genes, not just alkB alone .

What causes alk gene instability during continuous expression, and how can it be minimized?

Continuous expression of alk genes can lead to genetic instability, with several contributing factors:

  • Selective pressure: Cells with inactivated alk genes have growth advantages and can outcompete expressing cells

  • Metabolic burden: Sustained high-level expression creates strong selection for mutations that reduce expression

  • Membrane stress: Accumulation of membrane proteins can disrupt membrane integrity

  • Toxic intermediates: Alkane metabolism intermediates may damage cellular components

Studies have shown that continuous growth in the presence of inducers like dicyclopropylketone for approximately 10 generations leads to inactivation (but not elimination) of the alk genes, allowing cells to return to normal physiology and growth. To minimize this instability, researchers can:

  • Use tightly regulated inducible systems

  • Implement intermittent rather than continuous induction

  • Optimize media composition to reduce physiological stress

  • Consider host strain modifications to enhance stability

  • Monitor population heterogeneity during prolonged cultivation

How do deletions in alkB and alkJ affect expression-related physiological changes?

Deletions in alkB and alkJ have been shown to modify, but not completely eliminate, the physiological changes associated with alk gene expression:

  • alkB deletions: A 528-bp deletion in alkB still resulted in significant growth reduction and associated physiological effects, indicating that alkB is not solely responsible for these impacts.

  • alkJ considerations: AlkJ, another membrane-bound protein encoded by the alk operon, accounts for approximately 10% of total membrane proteins in P. oleovorans after induction, while it is barely detectable in E. coli W3110.

These findings suggest that physiological changes observed in Pseudomonas oleovorans during alk gene expression result from the cumulative effects of multiple alk-encoded proteins, particularly membrane-associated ones. The specific contribution of each protein may vary depending on the host organism and expression conditions. This understanding is crucial for designing robust expression systems and interpreting experimental results .

How can alkB diversity analysis inform bioremediation strategies for petroleum-contaminated environments?

AlkB diversity analysis can significantly inform bioremediation strategies for petroleum-contaminated environments by:

  • Identifying indigenous alkane-degrading communities: Using the combined primer approach can reveal the full diversity of alkB-containing bacteria present in contaminated soils.

  • Assessing degradation potential: Different alkB variants have different substrate specificities and activities, so understanding the diversity can predict the range of hydrocarbons that can be degraded.

  • Designing tailored bioaugmentation: Based on alkB diversity data, specific bacterial strains with appropriate alkB genes can be selected for bioaugmentation.

  • Monitoring bioremediation progress: Changes in alkB diversity and abundance during remediation can serve as functional biomarkers of hydrocarbon degradation.

  • Adapting strategies to environmental conditions: Different alkB variants may perform optimally under different environmental conditions, allowing for site-specific remediation approaches.

Research has shown that different sampling sites have particular sets of alkane-degrading bacteria with distinct alkB compositions. This site-specificity highlights the importance of characterizing the indigenous alkB diversity before implementing bioremediation strategies .

What are the implications of alkB structural variations for designing improved biocatalysts?

Understanding alkB structural variations has significant implications for designing improved biocatalysts:

  • Substrate specificity engineering: Knowledge of structure-function relationships in different AlkB variants can guide protein engineering to modify substrate range or specificity.

  • Stability enhancement: Identifying naturally occurring alkB variants with enhanced stability under extreme conditions can inform protein engineering strategies.

  • Activity optimization: Comparing catalytic efficiencies of different natural alkB variants can reveal key residues for improving activity.

  • Expression optimization: Structural variations may affect protein folding, membrane insertion, and stability, which are critical for recombinant expression.

  • Novel catalytic applications: Some alkB variants may catalyze reactions beyond typical alkane hydroxylation, opening possibilities for new biocatalytic applications.

The wide variation in alkB nucleotide sequences across bacterial strains represents a natural reservoir of enzyme diversity that can be exploited for biotechnological applications. Comprehensive analysis of this diversity using combined primer approaches provides a foundation for rational biocatalyst design .

How do host-specific factors influence the functionality of recombinant AlkB proteins?

Host-specific factors significantly influence the functionality of recombinant AlkB proteins through multiple mechanisms:

  • Membrane composition: The lipid composition of the host membrane affects AlkB insertion, stability, and activity.

  • Electron transport components: AlkB requires specific electron donors (rubredoxin and rubredoxin reductase) that may not be optimally expressed in heterologous hosts.

  • Post-translational modifications: Different hosts may process the AlkB protein differently, affecting its activity or stability.

  • Protein quality control systems: Host-specific chaperones and proteases can affect AlkB folding and turnover rates.

  • Metabolic context: The host's central metabolism affects the availability of cofactors and energy for AlkB function.

These factors explain why AlkB expression and activity can vary significantly between P. oleovorans and recombinant E. coli hosts. For example, while E. coli W3110 (pGEc47) can produce about five times more AlkB than P. oleovorans, functional outcomes may differ due to these host-specific factors. Understanding these interactions is essential for designing effective expression systems for biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.