Recombinant Alkylglycerol monooxygenase homolog (BE10.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
agmo-1; BE10.2; Alkylglycerol monooxygenase; Transmembrane protein 195 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-505
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
agmo-1
Target Protein Sequence
MNETAWLDRVFSNTSLGHRLLDRLTLTNLRHAFYLISPYETTVESIDDVPNYNAEVSAWW LVFLTAEFFILFISGHEDRFALNDSITSICAGMLSQCFKFGGRAVAIFLYVIVWDNWRIL ELPWDSPWTWIFCLFFQDFMYYLGHRAVHEAGFFWGLHTIHHSSEYYNFSTALRQAAIQD AGLAIYDCIQAFFIPPSIFLVHRYFSEIFQFIMHTSLVDTMGPLGLVFNTPSHHRVHHGR NPYCIDKNYGGVFIIWDKMFNTFEAERHDDPPIYGLVTNENTFNQIYLQFHALWDILIFK GFTKDVKGEPMFPGVVNKLKATVFPPGWFPGVPVTPFFHWMSMVNPAHGVPEPEKPVLRY SPPARILVKVYVASSFLLLLAIFFHFEYDRNHLSYLDCTVKIAYFVVTMQCFGAFFDMKW YARYIEIARCCGVLIYYGVLMFDHIGAGTHRLFVISLHIMAIALWTTDVLVEKLSQCCSK NQSINPEKGDLERAPEIASISKNVQ
Uniprot No.

Target Background

Function
Glyceryl-ether monooxygenase; cleaves the O-alkyl bond of ether lipids.
Database Links

KEGG: cel:CELE_BE10.2

STRING: 6239.BE10.2

UniGene: Cel.19986

Protein Families
Sterol desaturase family, TMEM195 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Alkylglycerol monooxygenase and its homolog BE10.2?

Alkylglycerol monooxygenase (AGMO) is a tetrahydrobiopterin-dependent enzyme that cleaves the ether bond of alkylglycerols and lyso-alkylglycerophospholipid species. It represents the only enzyme capable of performing this specific cleavage reaction in biological systems. The enzyme was identified through bioinformatic approaches and proteomic analysis as transmembrane protein 195 (TMEM195), a predicted membrane protein with previously unassigned function that occurs in bilateral animals . BE10.2 is the Caenorhabditis elegans homolog of AGMO and has been identified as a significant mediator in IGF/insulin-like signaling pathways. In genome-wide studies, BE10.2 was identified as one of the top hits out of 41 genes mediating daf2 gene action in C. elegans .

How is AGMO/BE10.2 regulated in different cellular contexts?

AGMO expression and activity are differentially regulated during macrophage differentiation. Studies have demonstrated that both AGMO expression and activity are up-regulated during differentiation of primary murine bone marrow-derived macrophages to the M2 phenotype, while inflammatory stimuli (leading to M1 polarization) down-regulate AGMO . In murine macrophage-like RAW264.7 cells, AGMO expression correlates with enzyme activity levels, suggesting transcriptional regulation as a primary control mechanism. Beyond macrophages, AGMO expression varies across different tissues, with male rat liver showing particularly high activity levels .

What cofactors are essential for AGMO/BE10.2 function?

Tetrahydrobiopterin is an absolute requirement for AGMO enzymatic activity. Like nitric oxide synthases and aromatic amino acid hydroxylases, AGMO depends on this cofactor for its function . Experimental evidence from lentiviral GCH1 (GTP cyclohydrolase I, the rate-limiting enzyme in tetrahydrobiopterin biosynthesis) knockdown models demonstrates that depletion of intracellular tetrahydrobiopterin significantly reduces AGMO activity in intact cells. This effect can be reversed by supplementation with sepiapterin, a GCH1-independent tetrahydrobiopterin precursor . Notably, unlike phenylalanine hydroxylase which requires cofactor presence for protein stabilization, AGMO protein can be expressed at normal levels in tetrahydrobiopterin-depleted cells but remains non-functional due to cofactor absence .

What strategies exist for generating and validating AGMO knockout models?

This duplication complicated genotyping by routine PCR methods but could be resolved using alternative approaches:

  • qPCR-based genotyping

  • Targeted locus amplification sequencing

  • Nanopore sequencing

The validation of AGMO knockout was ultimately confirmed by enzymatic activity measurements. Despite the duplication event, the knockout mouse model lacked AGMO enzyme activity, confirming its utility for studying the physiological role of this enzyme . This case illustrates the importance of multiple validation methods when creating genetically modified models.

How can researchers manipulate and measure AGMO activity in cellular systems?

Multiple complementary approaches can be used to manipulate and measure AGMO activity in cellular systems:

Genetic manipulation strategies:

  • RNA interference (RNAi): shRNA-mediated knockdown using lentiviral vectors (e.g., constructs shAGMO506, shAGMO847, and shAGMO1699 in RAW264.7 cells) can achieve approximately 10-fold reduction in AGMO activity .

  • Overexpression: Introduction of FLAG-tagged human AGMO can elevate enzymatic activity approximately 6-fold in RAW264.7 cells .

  • Heterologous expression: AGMO activity can be reconstituted in Xenopus laevis oocytes by injection of TMEM195 cRNA .

Activity measurement methods:

How does tetrahydrobiopterin availability impact AGMO function and broader lipid metabolism?

Tetrahydrobiopterin availability critically determines AGMO activity in intact cells. Experimental evidence shows:

  • GCH1 knockdown in RAW264.7 cells results in:

    • 14.0-fold reduced GCH1 activity

    • 14.2-fold diminished intracellular tetrahydrobiopterin levels

    • Significant reduction in pyrenedecanoic acid formation (indicating reduced AGMO activity)

    • Accumulation of 1-O-hexadecyl-sn-glycerol, a physiological AGMO substrate

  • Sepiapterin supplementation in GCH1 knockdown cells:

    • Restores diminished tetrahydrobiopterin levels

    • Recovers pyrenedecanoic acid formation

    • Reverses the accumulation of 1-O-hexadecyl-sn-glycerol

The impact of tetrahydrobiopterin depletion on AGMO activity extends to broad alterations in the cellular lipidome. Studies comparing lipid profiles between AGMO knockdown and GCH1 knockdown cells reveal remarkably similar patterns of lipid alterations, suggesting that most effects of tetrahydrobiopterin on the lipidome are mediated through its impact on AGMO function .

What challenges exist in isolating and purifying recombinant AGMO/BE10.2?

Isolating and purifying AGMO presents significant technical challenges:

  • Enzyme instability: Attempts to purify the protein from male rat liver (the source with highest activity) failed due to inherent instability of the enzyme activity .

  • Solubilization difficulties: The enzyme could not be fully solubilized, complicating purification efforts .

  • Analytical limitations: The necessity of HPLC analysis, which has limited throughput capacity (approximately 40 assays per day), restricts large-scale screening approaches .

  • Expression system limitations: Traditional functional expression screens requiring testing of approximately 100,000 clones were not feasible due to analytical constraints .

Alternative approaches that circumvented these challenges include:

  • Bioinformatic screening of candidate genes from databases

  • Proteomic analysis of partially purified enzyme

  • Testing of selected candidates in transfection experiments

  • Confirmation by expression in systems like Xenopus oocytes

How can researchers detect genomic alterations in genetically modified AGMO models?

Multiple complementary techniques are recommended to detect potential genomic alterations in AGMO knockout models:

  • Fluorescence in situ hybridization (FISH):

    • Useful for detecting integration of transgenic cassettes

    • In heterozygous animals, using probes specific for the chromosome and transgene cassette

    • Fiber-FISH on extended chromatin fibers can provide higher resolution analysis

  • PCR-based methods:

    • Standard PCR may miss duplications

    • Long-range PCR covering recombination sites

    • qPCR provides more quantitative assessment of gene copy number

  • Nanopore sequencing:

    • Provides comprehensive detection of structural variations

    • Can detect duplications missed by conventional quality control methods

    • Offers cost-effective quality assessment of gene editing

  • Targeted locus amplification sequencing:

    • Allows focused analysis of the modified genomic region

    • Helps resolve complex genomic rearrangements

These methods should be used in combination, as conventional quality control filters such as FISH or long-range PCR alone may miss certain types of genomic alterations, such as the 94 kb duplication observed in the Agmo locus during knockout generation .

What approaches can validate functional consequences of AGMO/BE10.2 manipulation?

To validate the functional consequences of AGMO manipulation, researchers should employ multiple approaches:

  • Enzymatic activity measurements:

    • Direct measurement of AGMO activity in tissue homogenates with saturating amounts of tetrahydrobiopterin

    • Comparison of activity levels between wild-type, heterozygous, and homozygous animals

    • Analysis across multiple tissues to capture tissue-specific effects

  • Gene expression analysis:

    • RT-qPCR to determine endogenous gene expression patterns

    • Correlation analysis between enzyme activity and gene expression

    • For example, AGMO activity and gene expression correlated significantly in both wild-type (p = 0.03 for females and p < 0.0001 for males) and heterozygous animals (p < 0.0001 for both females and males)

  • Lipidomic profiling:

    • Targeted LC-MS/MS methods to measure physiological AGMO substrates like 1-O-hexadecyl-sn-glycerol

    • Broader lipidomic analysis to assess impacts on various lipid classes

    • Comparison between direct AGMO knockdown and tetrahydrobiopterin depletion

  • Live-cell functional assays:

    • Monitoring metabolism of fluorescently labeled substrates like pyrenedecylglycerol

    • Time-resolved analysis of product formation

    • Complementation experiments using sepiapterin in tetrahydrobiopterin-depleted cells

What cell models are optimal for studying AGMO/BE10.2 function?

Several cell models have proven valuable for studying AGMO function:

  • RAW264.7 murine macrophage-like cells:

    • Express endogenous AGMO at significant levels

    • Amenable to lentiviral transduction for knockdown and overexpression studies

    • Support live-cell assays for AGMO activity using fluorescent substrates

    • Respond to tetrahydrobiopterin modulation

  • Chinese Hamster Ovary (CHO) cells:

    • Low background AGMO activity

    • Suitable for transfection experiments with AGMO expression constructs

    • Support coupled assays with fatty aldehyde dehydrogenase

  • Xenopus laevis oocytes:

    • Allow expression of AGMO through cRNA injection

    • Provide a system for functional confirmation of gene identity

    • Support measurement of tetrahydrobiopterin-dependent AGMO activity

  • Primary murine bone marrow-derived macrophages:

    • Allow study of AGMO regulation during physiological differentiation processes

    • Demonstrate differential regulation during M1/M2 polarization

The choice of cell model should consider factors such as endogenous AGMO expression, ease of genetic manipulation, and compatibility with activity measurement methods.

How might AGMO/BE10.2 function influence broader signaling pathways?

AGMO function may influence multiple signaling pathways through its impact on the cellular lipidome. Genome-wide approaches have identified several potential biological effects:

  • IGF/insulin-like signaling:

    • In C. elegans, BE10.2 (the AGMO homolog) is one of the top hits mediating daf2 gene action

    • This suggests a role in metabolic regulation and potentially lifespan control

  • Glucose metabolism:

    • A prominent human SNP (rs2191349) associated with high fasting glucose lies between the AGMO and DGKB genes

    • The potential mechanistic link between AGMO function and glucose homeostasis remains to be elucidated

  • Cardiovascular development:

    • AGMO (TMEM195) is one of 277 candidate genes implicated in congenital heart disease in humans

    • The mechanism connecting ether lipid metabolism to cardiac development warrants further investigation

The significant impact of AGMO manipulation on various lipid classes, including signaling lipids, provides a potential mechanistic explanation for these diverse biological associations identified through genome-wide approaches .

What are the implications of AGMO/BE10.2 in comparative model systems?

AGMO/BE10.2 research across different model systems reveals evolutionary conservation and specialization:

  • C. elegans:

    • BE10.2 functions in IGF/insulin-like signaling

    • Represents one of the evolutionarily older functions of AGMO-like proteins

    • Provides a simpler model system to study core functions

  • Mouse models:

    • Knockout models demonstrate the feasibility of complete AGMO inactivation

    • Allow tissue-specific analysis of enzyme activity and expression

    • Reveal potential developmental and physiological roles

  • Cell culture systems:

    • RAW264.7 macrophage models show regulation during immune cell differentiation

    • Suggest specialized roles in immune function that may have evolved in higher organisms

Comparative analysis across these systems helps distinguish fundamental conserved functions of AGMO/BE10.2 from more specialized roles that may have evolved in complex organisms.

What technical advancements could accelerate AGMO/BE10.2 research?

Several technical advancements could significantly accelerate research in this field:

  • Improved purification strategies:

    • Development of stabilization methods for the enzyme during purification

    • Design of affinity tags that maintain enzyme function

    • Exploration of detergent systems for optimal solubilization

  • High-throughput activity assays:

    • Alternatives to HPLC-based methods that limit throughput

    • Development of coupled assays compatible with plate reader formats

    • Fluorescence-based live-cell assays for screening applications

  • Structural biology approaches:

    • Crystallization of AGMO for structure determination

    • Cryo-EM studies of membrane-embedded enzyme

    • Computational modeling of substrate binding and catalysis

  • Advanced genome editing:

    • More precise CRISPR/Cas9 approaches for knockout and knockin models

    • Better validation methods to detect unintended genomic alterations

    • Tissue-specific and inducible manipulation systems

  • Systems biology integration:

    • Comprehensive lipidomic profiling in various genetic backgrounds

    • Integration with transcriptomic and proteomic datasets

    • Mathematical modeling of ether lipid metabolism networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.