Recombinant Alle alle NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Alle alle MT-ND6 is a genetically engineered variant of the NADH-ubiquinone oxidoreductase chain 6 protein, a core subunit of mitochondrial Complex I (NADH dehydrogenase). This enzyme catalyzes electron transfer from NADH to ubiquinone during oxidative phosphorylation, a process essential for ATP production . The recombinant form is expressed in heterologous systems like E. coli to enable biochemical and structural studies .

Production and Purification Methods

The protein is synthesized using E. coli expression systems, followed by affinity chromatography and lyophilization .

ParameterSpecification
Host SystemEscherichia coli
Purity≥90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer
StabilityAvoid repeated freeze-thaw cycles; stable at 4°C for ≤1 week

Functional Role in Mitochondrial Complex I

As a subunit of Complex I, MT-ND6 contributes to:

  • Electron Transfer: Mediates NADH → ubiquinone electron transport via FMN and Fe-S clusters .

  • Proton Pumping: Facilitates hydrogen ion translocation across the mitochondrial membrane, driving ATP synthesis .

  • Structural Integrity: Forms part of the transmembrane core essential for Complex I assembly .

Mutations in MT-ND6 are linked to mitochondrial disorders like Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome, making this recombinant protein valuable for studying disease mechanisms .

Research and Clinical Applications

  • Disease Modeling: Used to investigate LHON-associated mutations (e.g., T14484C, G14459A) and their impact on electron transport efficiency .

  • Drug Screening: Serves as a target for therapies aiming to restore Complex I function in mitochondrial disorders .

  • Biochemical Assays: Applied in enzymatic activity studies to quantify NADH dehydrogenase function under varying conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-173
Protein Length
full length protein
Species
Alle alle (Little auk) (Dovekie)
Target Names
Target Protein Sequence
MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASIAGCGWLLSLGVSFVSLVLFMVYL GGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSLITVLVVGVVVGGFVEYWDFGVITVDS VGMFSVRLDFGGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLTRGAIRAV
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), MT-ND6 is considered part of the minimal assembly required for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structural role of MT-ND6 in respiratory Complex I?

MT-ND6 is strategically positioned at the junction between the P and Q modules of respiratory Complex I. Research indicates that MT-ND6 contains multiple alpha-helical domains that facilitate critical protein-protein interactions within the complex. Specifically, the C-terminal region contains three alpha helices that interact with the Q module .

How are MT-ND6 mutations verified as pathogenic versus non-pathogenic?

Distinguishing pathogenic mutations from non-pathogenic polymorphisms in MT-ND6 requires a multi-step validation process:

  • Whole mtDNA sequencing to identify potential variants

  • Manual curation and bioinformatic analysis to filter variants based on conservation and predicted impact

  • Cybrid cell studies to confirm the functional impact of mutations

  • Complementation assays to verify causality

A cybrid (cytoplasmic hybrid) approach is particularly informative. In this method, patient-derived mitochondria containing the MT-ND6 variant are transferred to ρ⁰ cells (cells depleted of their own mtDNA). If the cybrid cells recapitulate the biochemical defect (typically reduced Complex I activity), this strongly supports pathogenicity .

For example, in one study, the m.14439G>A variant in MT-ND6 was confirmed pathogenic when cybrid cells showed reduced Complex I activity consistent with the patient's fibroblasts. Conversely, the m.1356A>G variant in mitochondrial 12S rRNA was shown to be non-pathogenic when Complex I activity was rescued in cybrid cells .

What experimental methods are used to assess MT-ND6 variant heteroplasmy?

Heteroplasmy (the presence of both mutant and wild-type mtDNA) is a critical parameter in mitochondrial genetics research. For MT-ND6 variants, several methodologies can quantify heteroplasmy levels:

  • PCR-Restriction Fragment Length Polymorphism (PCR-RFLP) analysis using appropriate restriction enzymes that distinguish between wild-type and mutant sequences. For instance, Hpy188I can be used for the m.14439G>A variant, while StyI has been employed for the m.1356A>G variant .

  • Mismatch PCR-RFLP for variants that don't naturally create or eliminate restriction sites.

  • Next-generation sequencing (NGS) provides the most comprehensive approach, allowing detection of heteroplasmy at levels as low as 1-2% . Analysis pipelines typically involve:

    • Quality filtering of reads (e.g., Trimgalore)

    • Alignment to the reference mitochondrial genome (e.g., BWA-MEM)

    • Variant calling using specific tools (e.g., GATK HaplotypeCaller and Mutect2)

    • Custom analysis to calculate heteroplasmy percentages

For example, in a hepatocellular carcinoma study, NGS revealed the m.14423A>- deletion at approximately 70% heteroplasmy in the tumor tissue .

How do frameshift mutations in MT-ND6 affect Complex I assembly compared to missense mutations?

Frameshift and missense mutations in MT-ND6 impact Complex I through distinct mechanisms:

Frameshift mutations (like m.14423A>- deletion) typically lead to:

Missense mutations (like m.14439G>A) typically cause:

  • Production of full-length proteins with altered amino acid composition

  • Variable impacts on Complex I activity depending on the specific residue affected

  • Often more selective disruption of specific functions rather than wholesale complex destabilization

To investigate these differences methodologically:

  • 2D Blue Native/SDS-PAGE is essential for comparing subunit composition of assembled Complex I. This technique reveals that frameshift mutations often lead to under-representation of multiple subunits in the assembled complex .

  • In-gel activity assays using NADH and nitrotetrazolium blue chloride can quantify functional impacts. Both mutation types typically reduce activity, but frameshift mutations often show more severe reductions .

The following table summarizes comparative effects based on research findings:

ParameterFrameshift Mutations (e.g., m.14423A>-)Missense Mutations (e.g., m.14439G>A)
Complex I StabilitySeverely reduced (~56%)Moderately reduced
Activity (per complex)Severely reduced (~55%)Variably reduced
Nuclear-encoded subunitsSignificantly decreasedLess affected
Mt-encoded subunitsVariable (ND1 unchanged, ND2/ND5 increased)Less affected
Molecular mechanismLoss of C-terminal α-helicesAltered protein conformation

What molecular dynamics approaches best predict the functional impact of novel MT-ND6 variants?

Molecular dynamics (MD) simulations offer powerful insights into how MT-ND6 variants affect protein stability and function. For optimal predictive value, researchers should implement the following methodological approach:

  • Structure preparation:

    • Compare multiple reference structures (e.g., CryoEM structures such as 5XTC, 5XTD, or AlphaFold models)

    • Create both wild-type and mutant models incorporating the variant of interest

  • Simulation parameters:

    • Use established force fields (e.g., AMBER99SB) for protein simulations

    • Immerse proteins in explicit solvent (TIP3P water box)

    • Implement periodic boundary conditions

    • Perform energy minimization (steepest descent, ~50,000 steps)

    • Equilibrate in NVT ensemble (100 ps) and NPT ensemble (100 ps)

    • Run production simulations for sufficient duration (≥200 ns)

  • Analysis metrics:

    • Residual Mean Square Fluctuation (RMSF) identifies regions of increased mobility

    • Solvent Accessible Surface Area (SASA) reveals conformational changes

    • Native contact preservation quantifies structural divergence

For example, MD simulations of ΔND6 revealed increased N-terminal mobility, altered SASA profiles, and loss of approximately 25% of native contacts, predicting the experimentally observed destabilization of Complex I .

When applying MD to novel variants, researchers should:

  • Prioritize variants in conserved regions

  • Compare simulation results to known pathogenic mutations

  • Validate computational predictions with experimental approaches like cybrid studies

How can researchers distinguish primary effects of MT-ND6 mutations from compensatory responses in experimental systems?

Distinguishing primary effects from compensatory responses remains challenging but is essential for accurate interpretation of MT-ND6 mutation studies. A systematic approach includes:

  • Temporal analysis: Examine changes immediately after introducing mutations (primary effects) versus later timepoints (compensatory responses).

  • Multi-level omics integration:

    • Transcriptomics to identify upregulated compensatory pathways

    • Proteomics to assess changes in Complex I subunit stoichiometry

    • Metabolomics to detect alterations in NADH/NAD+ ratios and downstream metabolic adaptations

  • Cross-platform validation:

    • Compare results in different experimental systems (fibroblasts, cybrids, isolated mitochondria)

    • Look for consistent findings that persist across systems

For example, research shows that while nuclear-encoded Complex I subunits typically decrease in cells with MT-ND6 mutations, other mitochondrially-encoded subunits like ND2 and ND5 may increase . This likely represents a compensatory response rather than a direct effect of the mutation.

Research in HCC tissue with the ΔND6 mutation demonstrated that mitochondrially-encoded proteins (ND2, ND5) significantly increased while nuclear-encoded proteins decreased . This opposing pattern suggests a compensatory mechanism attempting to maintain Complex I function despite the destabilizing mutation.

What are the optimal cybrid study designs for conclusively determining the pathogenicity of novel MT-ND6 variants?

Cybrid (cytoplasmic hybrid) studies represent the gold standard for establishing MT-ND6 variant pathogenicity. The optimal experimental design includes:

  • Cell source selection:

    • Patient-derived fibroblasts or platelets as mitochondrial donors

    • Established ρ⁰ cell lines (e.g., 143B osteosarcoma ρ⁰) as nuclear backgrounds

    • Multiple control cell lines with matching nuclear backgrounds

  • Cybrid generation protocol:

    • PEG-mediated fusion of enucleated patient cells with ρ⁰ cells

    • Selection in uridine-free media (eliminates unfused ρ⁰ cells)

    • Clonal isolation to establish homogeneous cybrid lines

    • Confirmation of mtDNA transfer and heteroplasmy levels

  • Comprehensive functional assessment:

    • Enzymatic assays of individual respiratory complexes

    • Oxygen consumption measurements

    • ATP synthesis capacity

    • ROS production

    • Mitochondrial membrane potential

  • Controls and validation:

    • Include both positive controls (known pathogenic mutations) and negative controls

    • Generate heteroplasmic cybrid lines with varying mutation loads to establish threshold effects

    • Perform genetic complementation studies when possible

A properly designed cybrid study should demonstrate that the biochemical phenotype tracks with the presence and heteroplasmy level of the MT-ND6 variant. For example, studies of the m.14439G>A mutation showed that cybrids carrying this variant exhibited reduced Complex I activity consistent with patient fibroblasts, while cybrids with the non-pathogenic m.1356A>G variant showed recovery of enzyme activity .

What are the most sensitive methods for detecting low-level heteroplasmy in MT-ND6 mutations?

Detecting low-level heteroplasmy (below 10%) requires specialized methodologies with high sensitivity. The following approaches offer increasing degrees of sensitivity:

  • Digital droplet PCR (ddPCR):

    • Partitions the PCR reaction into thousands of droplets

    • Each droplet serves as an individual reaction chamber

    • Allows absolute quantification of mutant vs. wild-type molecules

    • Detection sensitivity: ~0.1-1% heteroplasmy

    • Particularly useful for known mutations at specific sites

  • Next-Generation Sequencing with deep coverage:

    • Platform: Illumina HiSeq X or similar high-output systems

    • Library preparation: PCR-free methods to minimize amplification bias

    • Coverage requirements: >1000× for reliable detection below 1%

    • Bioinformatic pipeline specifications:

      • Trimming low-quality reads (Trimgalore, quality threshold >15)

      • Alignment to reference genome (BWA-MEM)

      • Variant calling with algorithms sensitive to low-frequency variants (GATK Mutect2)

      • Custom analysis to calculate heteroplasmy percentages

  • Single-cell approaches:

    • Isolation of individual mitochondria or mtDNA molecules

    • Amplification and sequencing of individual genomes

    • Provides heteroplasmy distribution rather than just average levels

When implementing these methods, researchers should:

  • Include spike-in controls with known heteroplasmy levels

  • Establish assay-specific detection limits using serial dilutions

  • Consider tissue-specific heteroplasmy patterns (e.g., blood may differ from muscle or brain)

How does MT-ND6 interact with other Complex I subunits during assembly, and what methods best capture these interactions?

MT-ND6 occupies a critical position at the junction between the P and Q modules of Complex I, suggesting important roles in both assembly and function. Research methodologies to investigate these interactions include:

  • Assembly pathway analysis:

    • Pulse-chase labeling of newly synthesized mitochondrial proteins

    • Gradient fractionation to isolate assembly intermediates

    • Identification of subunit interactions during different assembly stages

    • Blue Native PAGE combined with second-dimension SDS-PAGE to visualize assembly intermediates

  • Protein-protein interaction studies:

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation with antibodies against different complex subunits

    • Protein fragment complementation assays

  • High-resolution structural analysis:

    • Cryo-electron microscopy of intact Complex I

    • X-ray crystallography of subcomplexes

    • Nuclear magnetic resonance of isolated domains

Research has demonstrated that MT-ND6 contains three alpha helices in its C-terminal region that directly interact with the Q module . Loss of these helices in truncated variants (like ΔND6) significantly impacts the integration of other subunits, particularly those belonging to the P and Q modules.

The 2D Blue Native/SDS-PAGE approach has proven particularly valuable for assessing how MT-ND6 variants affect subunit integration into Complex I. This technique revealed that even when the holo-complex forms in the presence of truncated ΔND6, it contains reduced levels of multiple other subunits from both the P and Q modules .

What are the recommended controls and experimental designs for studying tissue-specific effects of MT-ND6 mutations?

Investigating tissue-specific effects of MT-ND6 mutations requires careful experimental design and appropriate controls. Recommended approaches include:

  • Tissue sampling strategy:

    • Paired sampling of affected and unaffected tissues from the same individual (e.g., tumor and adjacent normal tissue)

    • Sampling of multiple tissues with different metabolic profiles (e.g., brain, muscle, liver, blood)

    • Consideration of tissue-specific heteroplasmy levels

  • Essential controls:

    • Age-matched and sex-matched wild-type controls

    • Patient-matched tissues without the mutation

    • Positive controls with known pathogenic mutations affecting the same pathway

    • Additional control patients with similar clinical presentations but different genetic causes

  • Experimental design elements:

    • Multi-parameter assessment of mitochondrial function:

      • Complex I enzyme activity

      • BN-PAGE for complex assembly

      • Oxygen consumption rate

      • ATP production

      • ROS generation

    • Correlation of functional deficits with heteroplasmy levels

    • Consideration of tissue-specific nuclear backgrounds

  • Cellular models for tissue specificity:

    • Differentiated iPSCs from patient fibroblasts

    • Introducing MT-ND6 mutations into tissue-specific cell lines

    • Xenograft models to assess in vivo behavior

A comprehensive study design would include both ex vivo analysis of patient tissues and in vitro models with controlled genetic backgrounds. For example, researchers studying the m.14423A>- mutation in HCC compared tumor and distal tissue from the same patient while also analyzing tissues from a control patient without the mutation . This approach allowed them to distinguish mutation-specific effects from general cancer-related changes in mitochondrial function.

How do different MT-ND6 mutations correlate with specific clinical phenotypes?

MT-ND6 mutations manifest across a spectrum of clinical phenotypes, with genotype-phenotype correlations emerging from comparative studies:

MutationClinical PresentationBiochemical EffectsDisease Association
m.14439G>ALeigh syndromeComplex I deficiency (~50-60% reduction)Mitochondrial respiratory chain disorder (MRCD)
m.14423A>- (ΔND6)Hepatocellular carcinoma without metastasisComplex I instability (~56% reduction) and activity reduction (~55%)Cancer, possibly contributing to tumorigenesis
m.14484T>CVisual loss, scotomaMild Complex I deficiencyLeber's hereditary optic neuropathy (LHON)
m.14459G>ADystonia, Leigh syndromeComplex I deficiencyLHON/Dystonia syndrome

Research methodologies to establish these correlations include:

  • Comprehensive clinical phenotyping using standardized assessment tools

  • Biochemical profiling of patient samples (muscle biopsies, fibroblasts)

  • Functional validation in cybrid models

  • Meta-analysis of case reports and cohort studies

Important research considerations include:

  • Heteroplasmy levels across different tissues

  • Nuclear genetic modifiers

  • Environmental factors that may influence phenotypic expression

  • Age of onset and disease progression patterns

While some mutations (like m.14439G>A) present consistently with Leigh syndrome , others may show variable expressivity. Research suggests that MT-ND6 mutations affecting highly conserved residues or causing frameshift/truncation tend to produce more severe phenotypes.

What methodological approaches best identify novel therapeutic targets for MT-ND6-related disorders?

Identifying therapeutic targets for MT-ND6-related disorders requires multilayered approaches to understand disease mechanisms and identify intervention points:

  • High-throughput screening approaches:

    • Cell-based phenotypic screens using patient-derived cells or cybrids

    • Target-based screens focusing on Complex I assembly factors

    • Drug repurposing screens testing approved medications

    • Parameters to measure: Complex I activity, ATP production, cell viability

  • Network-based target identification:

    • Transcriptomic profiling to identify dysregulated pathways

    • Proteomics to map altered protein-protein interactions

    • Metabolomics to identify perturbed metabolic nodes

    • Integration of multiple omics datasets to identify convergent pathways

  • Genetic modifier screening:

    • CRISPR/Cas9 screens to identify genes that modulate MT-ND6 mutation phenotypes

    • RNA interference screens focusing on mitochondrial quality control pathways

    • Overexpression screens of candidate therapeutic genes

  • Target validation methodologies:

    • Genetic approaches (overexpression, knockdown)

    • Pharmacological approaches (small molecules, peptides)

    • Rescue experiments in patient-derived cells and cybrid models

Research into MT-ND6 mutations has identified several promising therapeutic avenues:

Each potential target requires rigorous validation across multiple experimental systems before clinical translation.

What are the most promising approaches for gene therapy targeting MT-ND6 mutations?

Gene therapy for MT-ND6 mutations presents unique challenges due to mitochondrial genetics but offers promising avenues for intervention:

  • Mitochondrially-targeted nucleases:

    • TALEN and ZFN approaches adapted for mitochondrial targeting

    • MitoZFNs designed to selectively eliminate mutant mtDNA

    • Evaluation criteria: specificity, efficiency, heteroplasmy shift

    • Delivery methods: viral vectors, lipid nanoparticles

  • Base editing technologies:

    • DddA-derived cytosine base editors (DdCBEs) adapted for mitochondrial targeting

    • Precision editing of specific MT-ND6 mutations without double-strand breaks

    • Quantification methods: Next-generation sequencing, digital droplet PCR

    • Cell-type specific considerations for delivery

  • Allotopic expression:

    • Nuclear expression of recoded MT-ND6 with mitochondrial targeting sequence

    • Optimization of codon usage and RNA stability

    • Protein import efficiency and Complex I integration assessment

    • Functional rescue evaluation in patient cells

  • Heteroplasmy shifting approaches:

    • Selective inhibition of mutant mtDNA replication

    • Enhancement of wild-type mtDNA propagation

    • Mitochondrial targeted restriction endonucleases

Key methodological considerations include:

  • Tissue-specific delivery systems

  • Threshold effects (determining minimum wild-type mtDNA needed for normal function)

  • Long-term stability of genetic modifications

  • Safety profiles of different approaches

The field currently lacks established methodologies for editing the mitochondrial genome , making this an important frontier for research. While challenges remain, recent advances in mitochondrial base editing offer promising avenues for treating MT-ND6 mutations in the future.

How might single-cell approaches advance our understanding of MT-ND6 mutation dynamics in heterogeneous tissues?

Single-cell technologies offer unprecedented insights into heteroplasmy distribution and cellular responses to MT-ND6 mutations:

  • Single-cell mtDNA sequencing methodologies:

    • Nanopore sequencing of individual mitochondrial genomes

    • Digital PCR-based approaches for single-cell heteroplasmy quantification

    • Fluorescence-based reporters for visualizing heteroplasmy in living cells

    • Computational approaches for resolving mtDNA variants at single-cell resolution

  • Single-cell multi-omics integration:

    • Simultaneous profiling of mtDNA variants and nuclear transcriptome

    • Correlation of heteroplasmy levels with gene expression patterns

    • Identification of compensatory transcriptional responses

    • Clustering of cells based on mitochondrial mutational profiles

  • Spatial transcriptomics approaches:

    • Preservation of tissue architecture while analyzing single-cell responses

    • In situ hybridization for mutant mtDNA detection

    • Correlation of mutation load with local tissue microenvironment

    • Identification of mutation spread patterns within tissues

  • Lineage tracing methodologies:

    • Following heteroplasmy dynamics through cell divisions

    • Quantifying selection pressures on different MT-ND6 variants

    • Measuring mutation accumulation rates in different cell types

    • Determining threshold effects in specific cellular lineages

These approaches would allow researchers to address key questions:

  • How heterogeneously are MT-ND6 mutations distributed within tissues?

  • Do certain cell types select for or against specific mutations?

  • What are the cell-autonomous versus non-cell-autonomous effects of mutations?

  • How do individual cells compensate for MT-ND6 dysfunction?

For example, in heterogeneous tissues like liver tumors with the m.14423A>- mutation, single-cell approaches could reveal whether all tumor cells carry similar mutation loads (~70% heteroplasmy) or whether there are distinct subpopulations with different mitochondrial genotypes driving various aspects of tumor biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.