This recombinant MC1R is produced in E. coli with an N-terminal His tag for affinity purification . Key specifications include:
| Property | Details |
|---|---|
| Expression System | E. coli |
| Purity | >90% (SDS-PAGE) |
| Storage Buffer | Tris/PBS-based buffer with 6% trehalose, pH 8.0 |
| Storage Conditions | -20°C/-80°C (lyophilized); avoid repeated freeze-thaw cycles |
| Reconstitution | Sterile water with 5–50% glycerol |
MC1R activation by α-MSH triggers cAMP production, driving melanocyte differentiation and eumelanin synthesis . Key functional traits include:
Basal Activity: Constitutive signaling observed in MC1R homologs , though Allen’s swamp monkey-specific data are pending.
Desensitization: GRK6-dependent phosphorylation at T308/S316 promotes β-arrestin-2 recruitment and receptor internalization .
Antagonism: Competitively inhibited by agouti signaling protein (ASIP) and β-defensin 3 (βD3) .
This recombinant protein is utilized for:
While MC1R functional divergence is well-documented in primates (e.g., Sulawesi macaques ), Allenopithecus nigroviridis MC1R shares conserved motifs (e.g., DRY, EL3) with human and murine homologs . Unique substitutions in its C-terminal domain (e.g., E304) may modulate receptor trafficking or signaling .
Current gaps include:
Allenopithecus nigroviridis MC1R is a G protein-coupled receptor with seven transmembrane domains characteristic of the melanocortin receptor family. The protein consists of 317 amino acids with several functionally important regions including an N-terminal extracellular domain, seven transmembrane helices, and a C-terminal intracellular domain that is critical for signal transduction . The receptor contains an amphipathic helix 8 (also called the fourth intracellular loop) in its C-terminus with multiple conserved basic residues that are essential for receptor function . This structural arrangement is consistent with other primate MC1R proteins, though specific amino acid differences contribute to species-specific functional characteristics.
The full amino acid sequence of Allenopithecus nigroviridis MC1R is:
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGAWCLEVSIPDGLFLSLGLVSLVENVLVVTAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVIDVITCSSMLLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFIAYYDHAAVILLCLVVFFLAMLVLMAVLYVHMLLARRACQHAQGIARLHKRQRPAHQGFGLKGAATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAFRSQELRRTLKEVLLCSW
Understanding this sequence is fundamental for designing expression constructs, developing site-directed mutagenesis experiments, and comparing functional domains across species.
A. nigroviridis MC1R shares significant homology with MC1R from other primates, though with important species-specific variations. While detailed comparative data specifically for A. nigroviridis is limited in the provided literature, studies of MC1R across other primate species reveal patterns relevant to evolutionary analysis. For example, macaque species show highly conserved MC1R sequences within species but fixed species-specific amino acid substitutions between closely related species .
MC1R sequence conservation tends to be highest in regions critical for receptor function, such as transmembrane domains and binding sites for α-MSH. Variations often occur in regions that modulate receptor activity rather than completely altering function, allowing for adaptive changes in pigmentation while maintaining core functionality . This pattern of conservation and variation likely extends to A. nigroviridis MC1R in relation to other primate MC1R sequences.
Recombinant expression of A. nigroviridis MC1R typically involves mammalian expression systems to ensure proper post-translational modifications and membrane insertion. Based on methodologies employed for MC1R from other species, the following approach is recommended:
Clone the full-length MC1R coding sequence (317 amino acids) into a mammalian expression vector with an appropriate promoter (e.g., CMV) .
Express the protein in mammalian cell lines such as COS-7 or HEK293 cells, which have been successfully used for other MC1R proteins .
Include an epitope tag (often N-terminal or C-terminal) to facilitate detection and purification, though care must be taken to ensure the tag doesn't interfere with receptor function .
Optimize transfection conditions using either lipid-based transfection reagents or electroporation for highest expression levels.
This approach parallels successful expression strategies for MC1R from other species and accommodates the particular structural features of G protein-coupled receptors.
The primary functional assay for MC1R activity is measurement of intracellular cAMP production, as MC1R signals through the cAMP pathway. Based on established protocols for other species' MC1R, the following methodology is recommended:
cAMP accumulation assay: Transiently transfect cells with the MC1R construct and measure both basal (constitutive) and agonist-induced cAMP production. This can be done using various commercial cAMP detection kits based on ELISA, FRET, or other detection methods .
Dose-response curves: Stimulate MC1R-expressing cells with increasing concentrations of α-MSH (typically ranging from 10^-12 to 10^-6 M) and measure cAMP accumulation to determine EC50 values and maximal responses .
Constitutive activity measurement: Compare baseline cAMP levels between MC1R-expressing cells and control-transfected cells (e.g., with GFP) to assess ligand-independent activity .
The functional data from studies of MC1R variants in macaques demonstrated both the importance of measuring constitutive activity and agonist-induced responses separately, as these can be differentially affected by mutations .
Site-directed mutagenesis is a powerful approach for investigating MC1R structure-function relationships:
Target selection: Based on comparative sequence analysis, target conserved residues or those that differ between A. nigroviridis and other primates. Key regions to consider include:
The DRY motif in the second intracellular loop (critical for G-protein coupling)
Basic residues in the C-terminal tail (implicated in signaling)
Transmembrane regions involved in ligand binding
Mutagenesis strategy: Use PCR-based site-directed mutagenesis to create specific amino acid substitutions. For example, the approach used for macaque MC1R involved creating point mutations like G304E, S104G, Y267C, and P153H to evaluate their effects on receptor function .
Functional assessment: Compare the mutant receptors to wild-type using cAMP assays to measure:
Changes in basal constitutive activity
Alterations in α-MSH binding affinity (EC50 values)
Differences in maximal cAMP production
This approach has successfully identified key functional residues in other primate MC1Rs. For example, in macaques, the G304E mutation in M. nigra MC1R and the S104G mutation in M. tonkeana MC1R both increased constitutive activation, while the Y267C mutation in M. hecki MC1R rescued binding affinity to α-MSH .
A. nigroviridis MC1R offers valuable opportunities for evolutionary analyses of primate pigmentation:
Comparative sequence analysis: By comparing A. nigroviridis MC1R sequences with those from other primates, researchers can identify conserved regions under purifying selection versus variable regions potentially subject to positive selection. This approach has revealed that MC1R is under strong functional constraint in African primates but shows relaxed constraint in non-African populations .
Reconstruction of ancestral sequences: Phylogenetic methods can be used to reconstruct ancestral MC1R sequences, which can then be synthesized and functionally characterized. This approach has been used with macaque MC1R to understand the evolution of functional differences between species .
Correlation with phenotypic variation: Researchers can analyze the relationship between specific MC1R variants and coat color patterns in A. nigroviridis and related primates. Studies in other species have demonstrated that MC1R variants often associate with specific melanic phenotypes .
Molecular clock analyses: Dating of MC1R mutations can provide insights into the timing of pigmentation adaptations during primate evolution, as has been done for human MC1R variants .
This comprehensive evolutionary approach can reveal how selection pressures have shaped MC1R function across primate lineages, including in A. nigroviridis.
MC1R polymorphisms can significantly alter receptor signaling through various mechanisms. To properly characterize these effects, a multi-parameter approach is recommended:
Constitutive activity: MC1R variants often show differences in basal, ligand-independent cAMP production. For example, in Sulawesi macaques, MC1R exhibits variable constitutive signaling between species, with stronger activity in M. nemestrina and M. maurus compared to other macaques .
Agonist sensitivity: Variants can alter the EC50 for α-MSH, reflecting changes in receptor-ligand affinity. In macaques, EC50 values ranged from 0.663 ± 0.339 nM for M. maurus to 1.886 ± 0.583 nM for M. tonkeana .
Maximal response: Some variants affect the maximum cAMP production capacity without changing sensitivity. M. nigra MC1R showed significantly lower maximal cAMP production compared to other species' MC1R proteins .
Response kinetics: Time-course experiments can reveal differences in the rate of cAMP accumulation or receptor desensitization between variants.
Data presentation: Results should be presented as both dose-response curves and quantitative parameters (EC50, Emax, basal activity) with appropriate statistical comparisons .
This comprehensive functional characterization approach has successfully identified distinct signaling properties of MC1R variants across species and should be applicable to A. nigroviridis MC1R research.
MC1R has been repeatedly implicated in adaptive evolution across vertebrates:
These approaches can elucidate how selection has shaped MC1R function in A. nigroviridis within the broader context of primate evolution.
Expressing functional G protein-coupled receptors like MC1R presents several challenges:
Low surface expression: MC1R may be retained intracellularly rather than properly transported to the plasma membrane.
Protein misfolding: As a multi-pass membrane protein, MC1R is prone to misfolding.
Solution: Express at lower temperatures (30-32°C instead of 37°C), add chemical chaperones to the culture medium, or co-express with molecular chaperones.
Constitutive activity variability: Baseline activity of MC1R can vary between experiments.
Verification of expression: Confirming successful expression of the recombinant receptor.
Solution: Use epitope tags (ensuring they don't interfere with function) or specific antibodies for western blotting and immunofluorescence. Flow cytometry can quantify surface expression levels.
Functional heterogeneity: MC1R may couple to different G proteins in different cell types.
Solution: Characterize MC1R function in multiple cell lines and with multiple readouts (cAMP, Ca2+ mobilization, ERK activation) for a comprehensive understanding.
These approaches can help overcome the technical challenges associated with recombinant MC1R expression and functional studies.
When faced with conflicting functional data for MC1R across different assay systems:
Consider expression system differences: Different cell types may provide varying cellular environments that affect MC1R function.
Evaluate assay sensitivity: Different cAMP detection methods have varying sensitivities.
Recommendation: Directly compare methods (e.g., radioimmunoassay, ELISA, FRET-based) using reference standards, and report detection limits.
Account for receptor expression levels: Variations in transfection efficiency or expression levels can impact functional readouts.
Recommendation: Quantify receptor expression (via western blot, ELISA, or flow cytometry) and normalize functional data accordingly.
Statistical considerations: Ensure appropriate statistical analyses for comparing MC1R variants.
Experimental conditions standardization: Temperature, pH, cell density, and passage number can affect results.
Recommendation: Establish and follow standardized protocols, and report all relevant experimental conditions in publications.
Dose-response curve analysis:
Variant comparison:
For comparing multiple MC1R variants, use one-way ANOVA followed by appropriate post-hoc tests
For pairwise comparisons, use t-tests with multiple testing corrections (e.g., Benjamini-Hochberg adjustment as used in macaque MC1R studies)
When comparing parameters across multiple experiments, consider mixed-effects models to account for inter-experimental variability
Basal activity analysis:
Calculate fold-increase in basal activity compared to mock-transfected cells
Use normalized data to account for variations in cell number and transfection efficiency
Apply appropriate transformations if data distribution is non-normal
Sample size considerations:
Data presentation:
Present both raw data points and means ± SEM or SD
Use consistent graphical representations for easier comparison between variants
Include appropriate statistical significance indicators on graphs
These statistical approaches, consistent with those used in published MC1R studies, will ensure robust and reproducible analysis of A. nigroviridis MC1R variant data.
CRISPR/Cas9 technology offers powerful approaches for studying MC1R function in vivo:
Genome editing in model organisms: While direct editing in A. nigroviridis may be challenging, researchers can:
Create MC1R knock-in mice expressing A. nigroviridis MC1R variants
Introduce specific A. nigroviridis MC1R mutations into melanocyte cell lines
Generate chimeric receptors with domains from A. nigroviridis MC1R in tractable model systems
Precise mutation introduction: Use CRISPR/Cas9 to create specific point mutations identified in comparative studies, such as those affecting key functional residues identified in other primates like the G304E, S104G, or Y267C mutations documented in macaque studies .
Regulatory element analysis: Target MC1R regulatory regions to understand transcriptional control mechanisms governing MC1R expression patterns.
Functional genomics screening: Develop CRISPR screens to identify genes that interact with MC1R in the melanogenesis pathway, potentially revealing species-specific interaction partners for A. nigroviridis MC1R.
Methodological considerations:
Design multiple guide RNAs targeting conserved regions of MC1R
Include appropriate knock-in templates containing A. nigroviridis sequences
Validate edits by sequencing and functional assays
Consider potential off-target effects
These CRISPR-based approaches would complement in vitro studies and provide more physiologically relevant insights into A. nigroviridis MC1R function.
Systems biology approaches can provide comprehensive understanding of MC1R's role within the broader pigmentation network:
Interactome mapping: Identify proteins that interact with A. nigroviridis MC1R using:
Proximity labeling techniques (BioID, APEX)
Co-immunoprecipitation followed by mass spectrometry
Membrane yeast two-hybrid systems
These approaches can reveal whether A. nigroviridis MC1R has unique interaction partners compared to other primate MC1Rs.
Transcriptomic analysis: Compare gene expression profiles in cells expressing wild-type versus variant A. nigroviridis MC1R to identify downstream pathways affected by receptor activity. This can reveal how MC1R variants influence the broader melanogenesis program.
Mathematical modeling: Develop computational models of the melanin synthesis pathway incorporating:
MC1R signaling dynamics (constitutive and ligand-induced)
Feedback mechanisms regulating MC1R activity
Cross-talk with other signaling pathways
Such models can predict how specific A. nigroviridis MC1R variants might affect pigmentation patterns.
Network analysis: Construct protein-protein interaction networks centered on MC1R to identify:
Hub proteins that may coordinate MC1R function with other cellular processes
Evolutionary conserved versus species-specific network components
Potential redundancies that might compensate for MC1R variants
Integration with phenotypic data: Correlate molecular network properties with coat color patterns in A. nigroviridis and related species to establish genotype-phenotype relationships at the systems level.
These systems approaches can provide a holistic understanding of how A. nigroviridis MC1R functions within cellular networks to control pigmentation.