Recombinant Alligator mississippiensis ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on your location and the order fulfillment method. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Alligator mississippiensis (American alligator)
Target Names
Target Protein Sequence
MNLFDQFLTPSLLGISLLMPALLMTTILLLNPKNQWLSHPTTTIKSWFINQAAKQIMTPI NPTGHKHSLILISLLILLSLTNLLGLLPYTFTPTTQLSMNMAIALPLWLVTVLIGLRTQP TTSLAHLLPEGTPMLLIPILILIETISLLIRPIALGVRLTANLTAGHLLIQLISIATLNL WFMMPPLSLLTSTVLILLLLLEFAVAMIQAYVFVLLLSLYLQENS
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is produced by electron transport complexes of the respiratory chain. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Database Links

KEGG: amj:808244

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Alligator mississippiensis MT-ATP6 typically expressed and purified for research use?

Recombinant Alligator mississippiensis MT-ATP6 is commonly expressed using in vitro E. coli expression systems . The methodological approach typically involves:

  • Cloning: The coding sequence is cloned into an expression vector with an N-terminal tag (commonly 10xHis-tag) for purification purposes .

  • Expression: The recombinant protein is expressed in E. coli under optimized conditions for membrane protein production.

  • Purification: Affinity chromatography using the His-tag is employed for initial purification, followed by additional chromatography steps if higher purity is required.

  • Quality Control: The purity is typically assessed using SDS-PAGE, with commercially available preparations generally exceeding 90% purity .

  • Formulation: The purified protein is provided either in liquid form in a Tris/PBS-based buffer (pH 8.0) or as a lyophilized powder with 6% trehalose as a stabilizing agent .

The expression region typically covers amino acids 1-225, representing the full-length mature protein .

What are the optimal storage conditions for recombinant MT-ATP6 to maintain structural integrity and function?

To maintain the structural integrity and functionality of recombinant Alligator mississippiensis MT-ATP6, the following storage conditions are recommended:

  • Temperature: Store at -20°C or preferably -80°C upon receipt .

  • Handling: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

  • Format considerations:

    • Liquid form has a typical shelf life of approximately 6 months at -20°C/-80°C

    • Lyophilized form maintains stability for approximately 12 months at -20°C/-80°C

  • Working aliquots: For short-term use, store working aliquots at 4°C for up to one week .

  • Buffer composition: The stability is enhanced in Tris-based buffers with 50% glycerol optimized for this specific protein .

The shelf life depends on multiple factors, including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself .

How does the structure and function of Alligator mississippiensis MT-ATP6 compare with human MT-ATP6, and what are the implications for evolutionary studies?

Comparing Alligator mississippiensis MT-ATP6 with human MT-ATP6 reveals important structural and functional conservation across evolutionary distance while highlighting key differences:

Structural Comparison:

  • Both proteins are encoded by mitochondrial DNA and are similar in length (225 amino acids for alligator; human MT-ATP6 is 226 amino acids)

  • Both contain transmembrane domains that form part of the proton channel in the F0 portion of ATP synthase

  • Key functional regions involved in proton translocation show considerable conservation

Functional Similarities:

  • Both serve as components of the proton channel in ATP synthase

  • Both are essential for coupling proton flow to ATP synthesis

  • Both interact with other subunits, particularly subunit c, to facilitate proton movement

The evolutionary conservation of MT-ATP6 across diverse species reflects its fundamental importance in cellular energy production. Research involving comparative studies between reptilian and mammalian MT-ATP6 can provide insights into the evolution of mitochondrial function and the adaptations of energy metabolism across vertebrate lineages .

Researchers investigating evolutionary aspects may be particularly interested in examining the tuatara genome, which contains a complete mitochondrial genome including MT-ATP6, as it represents an ancient reptilian lineage that diverged from other reptiles approximately 250 million years ago .

What experimental approaches are most effective for studying MT-ATP6 function in vitro?

Several experimental approaches have proven effective for studying MT-ATP6 function in vitro:

1. ATP Synthesis Assays:

  • Measure ATP production rates using luminescence-based assays

  • Compare ATP synthesis with different substrates (e.g., malate vs. succinate)

  • Assess the effects of known ATP synthase inhibitors, such as oligomycin

2. Proton Translocation Measurements:

  • Fluorescent probes to measure proton flux

  • Assessment of mitochondrial membrane potential (increased or decreased) using potentiometric dyes

3. Structural and Assembly Analysis:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) to assess complex V assembly

  • Clear Native PAGE (CN-PAGE) with milder detergents for more sensitive analysis of ATP synthase complexes

  • Immunoprecipitation and co-immunoprecipitation to study interactions with other subunits

4. Functional Characterization:

  • ATP hydrolysis assays to measure enzyme activity in the reverse direction

  • Comparing ATP synthesis vs. hydrolysis rates to assess coupling efficiency

  • Evaluation of oligomycin sensitivity, which indicates proper assembly of the F0 portion

5. Biophysical Techniques:

  • Cryo-electron microscopy to study protein structure

  • Patch-clamp techniques to measure proton currents through reconstituted channels

A comprehensive study might employ multiple approaches, as shown in the table below summarizing biochemical features observed in human MT-ATP6 variants:

ParameterTypical FindingsMethodological Approach
ATP SynthesisDecreased rate (variable severity)Luciferase-based ATP measurement
ATP HydrolysisOften preservedSpectrophotometric enzyme assays
Membrane PotentialAbnormally increased or decreasedPotentiometric fluorescent dyes
Complex AssemblyVariable (normal to impaired)BN-PAGE and immunoblotting
Oligomycin ResponseVariable sensitivityInhibitor titration experiments

How do specific mutations in MT-ATP6 affect ATP synthase assembly and function, and how can recombinant proteins help study these effects?

Mutations in MT-ATP6 can significantly impact ATP synthase assembly and function in several ways:

1. Proton Channel Disruption:

  • Mutations can disrupt the proton translocation pathway, affecting the efficiency of proton flow

  • This disruption can lead to increased mitochondrial membrane potential (as seen with m.8993T>G mutation) or decreased potential (as with m.9185T>C mutation)

2. Complex Assembly Impacts:

  • Some mutations impair the assembly of the complete ATP synthase complex

  • Others allow normal assembly but impair function of the assembled complex

3. Functional Consequences:

  • Decreased ATP synthesis rates with preserved ATP hydrolysis is a common biochemical finding

  • Abnormal sensitivity to oligomycin (increased or decreased) may indicate structural changes in the proton channel

Recombinant proteins serve as valuable tools for studying these effects through:

  • Site-directed mutagenesis to introduce specific disease-associated mutations

  • In vitro reconstitution experiments to assess functional impacts

  • Structural studies to determine how mutations alter protein conformation

  • Binding studies to evaluate interactions with other complex V subunits

A systematic analysis of multiple MT-ATP6 mutations has revealed diverse biochemical features:

MutationKey Biochemical FeaturesProposed Mechanism
m.8993T>GDecreased ATP synthesis, increased membrane potentialImpaired proton pumping with normal complex assembly
m.8993T>CDecreased ATP synthesis (milder than T>G), normal ATP hydrolysisPartial reduction of ATP synthesis due to proton pore structure changes
m.9176T>GDecreased ATP synthesis, increased membrane potentialImpaired proton pumping efficiency with normal holocomplex
m.9185T>CDecreased membrane potential, variable complex assemblyImpairment of proton pump

What are the applications of recombinant MT-ATP6 in studying mitochondrial diseases?

Recombinant MT-ATP6 proteins have numerous applications in mitochondrial disease research:

1. Functional Characterization of Disease Variants:

  • In vitro assays to determine the impact of specific mutations

  • Comparison of wild-type and mutant protein function to establish pathogenicity

  • Development of biochemical signatures for specific mutations

2. Antibody Development and Diagnostic Tools:

  • Production of specific antibodies against MT-ATP6 for research and diagnostic applications

  • Development of immunoassays to detect structural abnormalities in patient samples

3. Drug Screening Platforms:

  • Testing compounds that might restore function to mutant MT-ATP6

  • Identification of molecules that could bypass defective ATP synthase

  • Evaluation of ATP synthase inhibitors as research tools and potential therapeutics

4. Structure-Function Relationship Studies:

  • Investigation of how specific protein domains contribute to function

  • Understanding the mechanisms of proton translocation

  • Elucidation of protein-protein interactions within the ATP synthase complex

MT-ATP6 mutations cause several mitochondrial diseases, including Leigh syndrome (found in approximately 10% of cases) . The ability to produce and study recombinant proteins with disease-associated mutations provides crucial insights into disease mechanisms and potential therapeutic approaches.

Research has shown that different MT-ATP6 mutations exhibit varied biochemical profiles, necessitating patient-specific approaches to diagnosis and treatment. The difficulty in validating the pathogenicity of novel MT-ATP6 variants makes recombinant protein studies particularly valuable for clinical interpretation .

What methods can be used to assess proton translocation through the MT-ATP6 subunit?

Proton translocation through MT-ATP6 is a critical function that can be assessed using several sophisticated methods:

1. Membrane Potential Measurements:

  • Potentiometric fluorescent dyes (e.g., TMRM, JC-1) to directly measure mitochondrial membrane potential

  • Quantification of potential changes in response to substrates and inhibitors

  • Real-time monitoring of membrane potential changes

2. Proton Flux Assays:

  • pH-sensitive fluorescent probes to track proton movement

  • Stopped-flow spectroscopy to measure rapid kinetics of proton translocation

  • Reconstitution of purified MT-ATP6 into liposomes for controlled studies

3. Patch-Clamp Electrophysiology:

  • Direct measurement of proton currents through reconstituted channels

  • Assessment of channel conductance and gating properties

  • Evaluation of the effects of mutations on channel function

4. Structural Analysis Approaches:

  • Hydrogen/deuterium exchange mass spectrometry to identify proton-accessible regions

  • Molecular dynamics simulations to model proton movement through the channel

  • Site-directed mutagenesis to identify key residues involved in proton translocation

5. Coupling Efficiency Measurements:

  • Comparison of ATP synthesis rates with proton gradient formation

  • Oxygen consumption measurements correlated with ATP production

  • Assessment of the P/O ratio (ATP produced per oxygen consumed)

These methods can provide complementary information about how MT-ATP6 facilitates proton movement and how this function is affected by disease-causing mutations. The binding change hypothesis proposed by Paul Boyer describes how proton flow through MT-ATP6 drives the rotational catalysis of ATP synthesis .

How can researchers study the evolutionary conservation of ATP synthase function across species using recombinant proteins?

Studying evolutionary conservation of ATP synthase function across species is a valuable research approach that can be facilitated through recombinant proteins:

1. Comparative Functional Analysis:

  • Express MT-ATP6 from different species (alligator, human, yeast, etc.) and compare functional parameters

  • Assess ATP synthesis rates, proton translocation efficiency, and oligomycin sensitivity

  • Determine whether functional differences correlate with adaptive environmental pressures

2. Chimeric Protein Studies:

  • Create chimeric proteins combining domains from different species

  • Identify which regions are responsible for species-specific functional characteristics

  • Map evolutionarily conserved functional domains

3. Conservation of Antibacterial Properties:

  • Investigate whether the antibacterial activity identified in the N-terminal 65 residues of ATP5A1 (ATP synthase α subunit) is conserved across species

  • Compare antibacterial mechanisms between evolutionarily distant organisms

  • Explore potential applications in antimicrobial research

4. Structural Conservation Analysis:

  • Compare the amino acid sequences and structural features of MT-ATP6 across species

  • Identify conserved residues critical for function

  • Correlate structural conservation with functional importance

A significant finding from evolutionary studies is that the antibacterial activity of the N-terminal 65 residues of the ATP synthase α subunit is conserved throughout animal evolution, suggesting an ancient and important function beyond energy production .

The tuatara genome reveals that the mitochondrial genome, including MT-ATP6, maintains the standard arrangement of 13 protein-coding genes found across animals, contradicting previous reports that suggested some genes might be absent in this ancient reptile lineage .

What are the challenges and solutions in expressing and purifying functional MT-ATP6 for structural studies?

Expressing and purifying functional MT-ATP6 presents several challenges due to its hydrophobic nature and membrane localization:

Challenges:

  • Membrane Protein Expression:

    • Hydrophobic transmembrane domains can cause protein aggregation

    • Toxicity to expression hosts when overexpressed

    • Proper membrane insertion is essential for correct folding

  • Stability Issues:

    • Loss of structural integrity during solubilization and purification

    • Sensitivity to detergents used for membrane extraction

    • Degradation during purification process

  • Functional Assessment:

    • Difficulty in confirming that purified protein maintains native function

    • Requirement for reconstitution into artificial membrane systems

    • Necessity of other subunits for full complex assembly and function

Solutions and Approaches:

  • Optimized Expression Systems:

    • Use of specialized E. coli strains designed for membrane protein expression

    • Implementation of lower induction temperatures to slow expression and improve folding

    • Addition of fusion tags that enhance solubility and membrane targeting

  • Purification Strategies:

    • Careful selection of mild detergents that maintain protein structure

    • Affinity purification using N-terminal tags (e.g., 10xHis-tag)

    • Size exclusion chromatography to remove aggregates and impurities

  • Stabilization Methods:

    • Addition of lipids during purification to maintain native-like environment

    • Use of stabilizing agents like trehalose in buffer formulations

    • Flash-freezing of purified protein in small aliquots to prevent degradation

  • Quality Control:

    • SDS-PAGE analysis to assess purity and integrity

    • Functional assays to confirm that purified protein retains activity

    • Circular dichroism to verify secondary structure

When working with recombinant Alligator mississippiensis MT-ATP6, researchers should consider expressing the protein with appropriate tags for purification while ensuring these modifications don't interfere with protein function. The recombinant protein is typically provided with either liquid or lyophilized formulations, each with specific storage requirements to maintain stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.