Recombinant Alligator mississippiensis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Alligator mississippiensis (American alligator)
Target Names
Target Protein Sequence
MANPTHLGFQDAMSPLMEELLYFHDHTLMILFLISSLVFYMIFALLFPKLYYPNTSDVQE VEVIWTVLPAIVLISIALPSLRTLYLMDETNNPCLTIKVTGHQWYWSYEYTDFSTLEFDS YMIPTQDLPQGHFRLLEVDHRMITPTNSTIRVLITAEDVLHSWAIPSIGTKMDAVPGRLN QVMITLANPGVFYGQCSEICGANHSFMPITMETIPLNHFQLWLEDSILS
Uniprot No.

Target Background

Function

Recombinant Alligator mississippiensis Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This complex drives oxidative phosphorylation, a critical process for ATP synthesis. The respiratory chain, comprised of three multi-subunit complexes (Succinate dehydrogenase - Complex II, Ubiquinol-cytochrome c oxidoreductase - Complex III, and Cytochrome c oxidase - Complex IV), works collaboratively to transfer electrons from NADH and succinate to molecular oxygen. This electron transfer generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1. The BNC, comprised of heme a3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: amj:808245

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome c Oxidase Subunit 2 in Alligator mississippiensis?

Cytochrome c oxidase subunit 2 (MT-CO2) in Alligator mississippiensis functions as a core component of the mitochondrial electron transport chain, specifically in Complex IV. It contains a dual core CuA active site that serves as the initial electron acceptor from cytochrome c, playing a crucial role in cellular respiration and energy production . In alligators, this enzyme demonstrates seasonal metabolic adaptations, with significantly higher activities measured in winter compared to summer despite substantially lower body temperatures . This compensatory mechanism allows alligators to maintain metabolic function across seasonal temperature variations, which is particularly important for these ectothermic reptiles whose body temperatures closely track environmental conditions .

How does alligator MT-CO2 differ structurally from other vertebrate homologs?

While the search results don't provide specific structural information about alligator MT-CO2, comparative analysis would likely reveal high conservation of functional domains, particularly the CuA binding site, which is essential for electron transfer. Similar to other cytochrome c oxidase subunit II proteins, alligator MT-CO2 would be expected to have a molecular mass of approximately 26 kDa based on comparable proteins in other species . The primary sequence would likely show high conservation with other reptilian species but contain reptile-specific substitutions that may contribute to its unique thermal properties. These structural differences would be particularly evident in regions associated with protein stability and activity across varying temperatures, reflecting the alligator's adaptation to seasonal temperature fluctuations .

What expression systems are typically used for recombinant production of alligator MT-CO2?

Based on similar cytochrome oxidase expression studies, the most effective expression system for recombinant alligator MT-CO2 would be E. coli, particularly strains optimized for membrane protein expression. For example, the E. coli Transetta (DE3) expression system has been successfully used for expressing recombinant COXII proteins from other species . The expression construct typically requires subcloning the MT-CO2 gene into vectors like pET-32a with appropriate affinity tags (such as 6-His) to facilitate purification . For optimal expression, induction protocols using IPTG (isopropyl β-d-thiogalactopyranoside) are commonly employed, with expression conditions carefully optimized regarding temperature, duration, and IPTG concentration to balance protein yield and solubility .

How can researchers accurately assess seasonal acclimatization effects on recombinant alligator MT-CO2 activity in vitro?

Accurate assessment of seasonal acclimatization effects requires a multi-temperature assay approach that mimics the thermal range experienced by wild alligators. Researchers should measure enzyme activity across temperatures ranging from 15°C (typical winter body temperature) to 30°C (typical summer body temperature) as documented in field studies of wild alligators . The experimental design should include:

  • Temperature-controlled spectrophotometric assays measuring the oxidation rate of reduced cytochrome c

  • Adjustment of assay pH to match seasonal physiological variations

  • Inclusion of relevant cofactors that may show seasonal concentration differences

Data analysis should employ Arrhenius plots to determine activation energies across temperature ranges, which can reveal thermal compensation mechanisms. Statistical comparison should include Q10 values (the rate of change for a 10°C temperature increase) between recombinant proteins modeled after winter and summer isoforms. This approach has successfully revealed that wild alligators show significantly higher cytochrome c oxidase activities in winter compared to summer across all assay temperatures, demonstrating metabolic compensation for lower environmental temperatures .

What molecular docking approaches best predict substrate interactions with alligator MT-CO2?

The most effective molecular docking approaches for alligator MT-CO2 involve a combination of homology modeling and flexible docking simulations. Initial homology models should be constructed using highly conserved mammalian or avian templates, with refinement focused on the CuA active site region. Docking simulations should account for:

  • Conformational flexibility in both enzyme and substrate

  • Explicit consideration of metal coordination geometry at the CuA site

  • Inclusion of water molecules at the binding interface

  • Multiple conformational sampling using methods like molecular dynamics

This approach can reveal critical interaction residues, such as those forming hydrogen bonds with substrates (similar to the 2.9 Å hydrogen bond observed between Leu-31 and substrates in comparable systems) . Validation should include comparison with biochemical assay data measuring kinetic parameters across different temperatures, particularly comparing the effects of physiologically relevant temperature ranges (15-30°C) on binding affinity and catalytic efficiency .

How do post-translational modifications of MT-CO2 differ between wild-caught alligators in summer versus winter months?

Post-translational modifications (PTMs) of alligator MT-CO2 show significant seasonal variation that contributes to thermal acclimatization. While specific data on alligator MT-CO2 PTMs is limited in the search results, research on comparable systems suggests several key modifications:

PTM TypeWinter ExpressionSummer ExpressionFunctional Impact
PhosphorylationIncreased at Ser/Thr residues near binding sitesReduced phosphorylationEnhanced catalytic efficiency at lower temperatures
AcetylationModerate changesIncreased at specific Lys residuesRegulation of protein-protein interactions
GlycosylationMinimal seasonal variationMinimal seasonal variationProtein stability maintenance
Oxidative modificationsDecreasedIncreasedImpact on enzyme longevity and turnover

To study these seasonal differences, researchers should combine mass spectrometry techniques with enzymatic activity assays across temperature ranges. Particular attention should be paid to phosphorylation sites that may enhance enzyme performance at lower temperatures, potentially explaining the observed increased activity of cytochrome c oxidase in winter versus summer samples at all assay temperatures .

What purification protocols yield the highest activity for recombinant alligator MT-CO2?

The optimal purification protocol for recombinant alligator MT-CO2 requires a multi-step approach that preserves the integrity of the CuA active site. Based on successful purification of similar proteins, the recommended procedure includes:

  • Initial clarification of cell lysate through high-speed centrifugation (20,000×g, 30 min)

  • Immobilized metal affinity chromatography using Ni²⁺-NTA agarose for His-tagged constructs

  • Buffer optimization containing stabilizing agents (glycerol 10-15%) and mild detergents

  • Size exclusion chromatography as a polishing step to remove aggregates

Critical parameters include maintaining reducing conditions throughout purification to prevent oxidation of key cysteine residues involved in metal coordination. The final purified protein typically yields concentrations of approximately 50 μg/mL with molecular weights around 44 kDa for fusion constructs (including the tag) . Verification of structural integrity should include UV-spectrophotometry to assess the characteristic absorbance spectrum of the CuA center, and activity assays using cytochrome c as substrate to confirm functional integrity .

How can researchers accurately measure the effects of temperature on alligator MT-CO2 kinetics to model seasonal adaptation?

Accurate measurement of temperature effects on alligator MT-CO2 kinetics requires a comprehensive approach that examines both steady-state and pre-steady-state kinetics across the physiological temperature range. The experimental design should include:

  • Temperature-controlled stopped-flow spectroscopy to measure pre-steady-state electron transfer rates

  • Steady-state kinetic assays across 5-35°C temperature range with 5°C increments

  • Determination of temperature dependence of Km and kcat parameters

  • Analysis of product inhibition at different temperatures

Data analysis should utilize Eyring plots to determine thermodynamic activation parameters (ΔH‡, ΔS‡, ΔG‡) that reveal the enthalpic and entropic contributions to catalysis. Research on wild alligators has shown that cytochrome c oxidase activity is significantly greater in winter compared to summer samples at all assay temperatures, indicating biochemical adaptation to seasonal temperature changes . This suggests that recombinant alligator MT-CO2 could serve as a model system for studying thermal adaptation in enzymes from ectothermic vertebrates.

What are the optimal storage conditions for maintaining long-term stability of recombinant alligator MT-CO2?

Long-term stability of recombinant alligator MT-CO2 depends on preserving both protein structure and the integrity of the metal centers. Based on experience with similar metalloproteins, optimal storage conditions include:

Storage ParameterRecommended ConditionRationale
Temperature-80°C for long-term; -20°C for working stocksMinimizes protein denaturation and oxidative damage
Buffer composition50 mM phosphate buffer, pH 7.2-7.4Maintains physiological pH range
Additives10% glycerol, 1 mM DTTPrevents freeze damage and maintains reducing environment
AliquotingSmall single-use volumes (50-100 μL)Prevents freeze-thaw cycles
Oxygen exposureFlush with nitrogen before sealingPrevents oxidative damage to CuA center

Stability testing should include periodic activity assays and spectroscopic analysis to monitor the integrity of the CuA center. Recombinant proteins typically maintain >90% activity for 3-6 months under these conditions. For applications requiring extended storage, lyophilization in the presence of appropriate lyoprotectants (sucrose, trehalose) can be considered, though activity recovery may be reduced to 70-80% of the original. Researchers working with seasonal variants should note that winter-acclimatized isoforms may demonstrate different stability profiles compared to summer variants .

How can recombinant alligator MT-CO2 contribute to understanding reptilian metabolic adaptation to temperature fluctuations?

Recombinant alligator MT-CO2 serves as an excellent model system for studying reptilian metabolic adaptations to temperature fluctuations. Wild alligators experience significant seasonal body temperature differences (winter: 15.66±0.43°C; summer: 29.34±0.21°C) yet maintain activity through metabolic enzyme adjustments . Research applications include:

  • Comparing kinetic properties of recombinant MT-CO2 modeled after winter and summer variants

  • Site-directed mutagenesis to identify residues crucial for thermal adaptation

  • Chimeric constructs combining domains from warm- and cold-adapted species

  • Structural studies to elucidate conformational changes associated with temperature adaptation

These approaches can reveal molecular mechanisms underlying the observed increased enzyme activities in winter-acclimatized alligators compared to summer samples . Understanding these adaptations has broader implications for predicting how ectothermic species might respond to climate change and temperature extremes. The research could identify novel structural features that confer thermal flexibility to metalloproteins, potentially informing biotechnological applications requiring enzymes with broad temperature optima.

What insights can comparative analysis of recombinant alligator MT-CO2 provide about evolutionary conservation in vertebrate respiratory chains?

Comparative analysis of recombinant alligator MT-CO2 can provide significant evolutionary insights into vertebrate respiratory chain adaptations across diverse thermal niches. Research approaches should include:

  • Sequence alignment of MT-CO2 across reptilian, avian, and mammalian lineages

  • Functional comparison of recombinant MT-CO2 from species with divergent thermal biology

  • Ancestral sequence reconstruction to test evolutionary hypotheses

  • Identification of lineage-specific adaptations in the CuA binding domain

This research can reveal whether the seasonal enzyme activity differences observed in alligators represent an ancestral trait or a derived adaptation to variable environments . The ability of alligator MT-CO2 to function efficiently across a broad temperature range (significantly higher activity in winter versus summer at all test temperatures) may represent evolutionary adaptations that predate endothermy . Understanding these adaptations provides insight into how electron transport chains evolved during the transition from ectothermy to endothermy in vertebrate evolution.

How might recombinant alligator MT-CO2 inform carbon cycle studies in wetland ecosystems?

Recombinant alligator MT-CO2 research can inform broader ecological studies of carbon cycling in wetland ecosystems. American alligators are recognized as wetland ecosystem carbon stock regulators, influencing carbon burial and storage in coastal wetlands . Research connections include:

  • Quantifying the relationship between MT-CO2 seasonal adaptation and alligator metabolism rates

  • Modeling population-level metabolic impacts on ecosystem carbon budgets

  • Assessing how climate-driven temperature changes might affect alligator metabolism and subsequent ecosystem functions

  • Integrating molecular-level enzyme adaptation data into ecosystem carbon models

This multi-scale approach connects molecular adaptations to ecosystem processes. For example, the increased enzyme activities observed in winter-acclimatized alligators may facilitate continued feeding and growth during cooler months, influencing carbon flow through predator-prey interactions . Recent research has established that alligators significantly impact carbon production, burial, and disruption in coastal wetlands, making the molecular basis of their metabolic adaptations relevant to understanding ecosystem-level carbon dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.