Recombinant Alligator mississippiensis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics and Structure

NADH-ubiquinone oxidoreductase chain 3 from Alligator mississippiensis is a mitochondrially-encoded protein that functions as a component of the respiratory chain complex I. The protein is identified in UniProt database with the accession number O47874 . As a recombinant protein, it is available in quantities such as 50 μg for research applications, with production processes designed to maintain structural integrity and functional properties. The protein is commonly referred to by several names including NADH-ubiquinone oxidoreductase chain 3, NADH dehydrogenase subunit 3, and its gene designations include MT-ND3, MTND3, NADH3, and ND3 .

The amino acid sequence of MT-ND3 from Alligator mississippiensis includes the following: "MNLFImLTMSSITVSIVVALNLLTAKTSPDPEKLSPYECGFDPLGSARLPLSIRFFMVGILFLLFDLEIAILLPLTWAIHTLNPLKTITWAIIIFLFLFIGLAYEWLQGGLEWAE" . This sequence represents the functional expression region spanning positions 1-115 of the protein. The composition and arrangement of these amino acids contribute to the protein's three-dimensional structure and its ability to participate in electron transport activities within the mitochondrial inner membrane.

Research Applications and Significance

The recombinant Alligator mississippiensis MT-ND3 has several potential research applications, particularly in comparative studies of mitochondrial function across species. As a component of complex I, this protein can be utilized in investigations of evolutionary conservation of mitochondrial respiratory processes. Additionally, the protein can serve as a tool in ELISA-based detection systems, as indicated by its availability as an ELISA recombinant protein .

Studies involving complex I have broader implications for understanding mitochondrial dysfunction in various pathological conditions. For instance, complex I inhibition has been associated with increased oxidative stress and mitochondrial morphological alterations . Research has shown that dysfunction of complex I can lead to increased reactive oxygen species production, which has been implicated in neurodegenerative disorders such as Parkinson's disease .

Relationship to Mitochondrial Dysfunction and Disease Models

While the specific role of alligator MT-ND3 in disease models is not directly addressed in the search results, studies on homologous proteins in other species provide valuable insights. Complex I dysfunction has been extensively studied in relation to Parkinson's disease (PD) pathogenesis, with inhibitors such as 1-methyl-4-phenylpyridinium ion (MPP+) and rotenone used as experimental models .

Research has demonstrated that impaired complex I activity leads to decreased ATP production and increased oxidative stress, which can trigger apoptotic signaling pathways . The regulation of complex I activity involves various factors, including glycogen synthase kinase-3β (GSK3β), which has been shown to inhibit complex I when its activity is increased within mitochondria . These regulatory mechanisms represent potential therapeutic targets for conditions associated with mitochondrial dysfunction.

Complex I inhibition also affects mitochondrial morphology, with research indicating visible changes in mitochondrial structure following disruption of normal complex I function . These observations underscore the integral role of proteins like MT-ND3 in maintaining not only the functional but also the structural integrity of mitochondria.

Comparative Analysis with Other Species

The Alligator mississippiensis MT-ND3 represents one variant of a protein that is highly conserved across multiple species. Recombinant versions of MT-ND3 from various species, including human, bovine, pig, rabbit, sheep, cat, chicken, and horse, are available for comparative research purposes . This diversity of sources enables evolutionary and functional comparative studies that can elucidate the conservation and specialization of mitochondrial respiratory components across different taxonomic groups.

Such comparative analyses can provide insights into the evolutionary adaptations of mitochondrial function in response to different metabolic demands and environmental conditions. The availability of both full-length and partial recombinant proteins from various species facilitates these comparative investigations .

Technical Considerations for Experimental Use

When utilizing recombinant Alligator mississippiensis MT-ND3 in research contexts, several technical considerations must be addressed. The protein's stability is a primary concern, as indicated by the strict storage recommendations to prevent degradation . Additionally, the production method, including the selection of appropriate tag types, can influence the protein's functionality in experimental settings.

For enzymatic assays measuring complex I activity, standardized protocols must account for the specific characteristics of the alligator protein. While general methods for assessing complex I function exist, optimization may be required when working with the recombinant alligator protein to ensure accurate and reproducible results .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Alligator mississippiensis (American alligator)
Target Names
Target Protein Sequence
MNLFIMLTMSSITVSIVVALNLLTAKTSPDPEKLSPYECGFDPLGSARLPLSIRFFMVGI LFLLFDLEIAILLPLTWAIHTLNPLKTITWAIIIFLFLFIGLAYEWLQGGLEWAE
Uniprot No.

Target Background

Function
This protein represents the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a crucial component of the minimal assembly required for catalytic activity. Complex I plays a vital role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links

KEGG: amj:808236

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND3 in Alligator mississippiensis mitochondria?

MT-ND3 functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor. It is essential for the catalytic activity of complex I in the American alligator, as in other vertebrates . In alligators specifically, this protein plays a crucial role in cellular energy production, particularly in tissues with high metabolic demands such as cardiac tissue . The absence of functional ND3 polypeptides prevents the assembly of the complete 950-kDa complex I structure and suppresses enzyme activity .

How does Alligator mississippiensis MT-ND3 differ structurally from human MT-ND3?

While both human and alligator MT-ND3 serve similar functions in complex I, several key differences exist:

FeatureHuman MT-ND3Alligator MT-ND3Significance
Codon usageDifferent codon biasUnique codon preferencesAffects expression efficiency in recombinant systems
Start codonATA in native mRNAVaries; often non-ATGImportant consideration when designing recombinant constructs
Protein sequence conservationReference~70-85% similarity to humanAffects antibody cross-reactivity and functional studies
Post-translational modificationsWell characterizedLess characterizedMay influence protein stability and function

When designing recombinant expression systems, these differences must be considered, particularly the start codon which often requires modification from ATA to ATG in expression constructs to ensure proper translation initiation .

What techniques are used to isolate mitochondria from Alligator mississippiensis tissues for MT-ND3 studies?

The isolation of mitochondria from alligator tissues requires specific adaptations to standard protocols:

  • Tissue selection: Cardiac tissue is frequently used due to its high mitochondrial content and relevance to developmental studies .

  • Homogenization buffer composition: Typically contains 250 mM sucrose, 10 mM HEPES, 1 mM EGTA, pH 7.4, with protease inhibitors.

  • Differential centrifugation protocol:

    • Initial centrifugation at 1,000g for 10 minutes to remove cellular debris

    • Supernatant centrifugation at 10,000g for 10 minutes to pellet mitochondria

    • Washing steps with RNase treatment to remove contaminating RNA from the mitochondrial surface

  • Quality assessment: Mitochondrial preparation quality should be verified by measuring respiratory control ratios using a microrespirometer .

How can I design primers for cloning Alligator mississippiensis MT-ND3 for recombinant expression?

Designing primers for cloning alligator MT-ND3 requires careful consideration of several factors:

  • Reference sequence selection: The complete mitochondrial genome of Alligator mississippiensis should be used as reference.

  • Primer design principles:

    • Include appropriate restriction sites at 5' ends (e.g., ClaI, HindIII, or NcoI) for subsequent cloning steps

    • Consider codon optimization for the expression system being used

    • Modify the start codon from the native sequence to ATG if necessary

    • Ensure the reverse primer includes a strong termination signal

  • Example primer design approach:

    • Forward primer: 5'-ATCGATAAGCTTCAGCAGTACNNNNNNNNNNNN-3' (includes HindIII site)

    • Reverse primer: 5'-AAGCTTCCATGGCNNNNNNNNNNNNNNNNNNN-3' (includes NcoI site)

  • Verification: After amplification, sequence the PCR products to confirm fidelity before proceeding with cloning into an appropriate expression vector .

What expression systems are optimal for producing recombinant Alligator mississippiensis MT-ND3?

The choice of expression system for recombinant alligator MT-ND3 depends on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
Bacterial (E. coli)High yield, simple cultureLacks PTMs, inclusion body formation commonInitial structural studies, antibody production
Mammalian cellsNative-like folding, PTMsLower yield, higher costFunctional studies, complex assembly
Baculovirus/insect cellsHigh yield, some PTMsModerate complexityLarge-scale protein production
Cell-free systemsRapid, handles toxic proteinsLower yield, expensivePreliminary functional assays

For mitochondrial proteins like MT-ND3, special considerations include:

  • Codon optimization: Essential for expression in heterologous systems, particularly for converting the mitochondrial genetic code to nuclear genetic code .

  • Mitochondrial targeting sequences: Required when expressing in cellular systems to ensure proper localization to mitochondria .

  • Solubility tags: Addition of solubility-enhancing tags (MBP, SUMO) can help overcome issues with hydrophobic membrane proteins.

How can I assess the successful incorporation of recombinant MT-ND3 into Complex I?

Assessment of recombinant MT-ND3 incorporation into Complex I requires multiple complementary approaches:

  • Protein level analysis:

    • Western blotting with antibodies against MT-ND3 and other Complex I subunits

    • Blue Native PAGE to visualize intact Complex I assembly (950 kDa)

    • Immunoprecipitation of Complex I followed by mass spectrometry

  • Functional analysis:

    • NADH:ubiquinone oxidoreductase activity assays using isolated mitochondria

    • Oxygen consumption measurements with a microrespirometer

    • ATP synthesis rate determination

  • Structural verification:

    • Cryo-EM of isolated Complex I to confirm structural integrity

    • Cross-linking studies to verify proper subunit interactions

Successful incorporation should restore Complex I assembly and activity in cells with deficient native MT-ND3, with a measurable improvement in ATP production .

What approaches can be used to study MT-ND3 variants in Alligator mississippiensis under different environmental conditions?

Environmental adaptation studies of MT-ND3 in alligators can employ several sophisticated approaches:

  • Controlled incubation experiments:

    • Alligator eggs can be incubated under varying oxygen concentrations (e.g., 10% vs. 21%) to mimic natural environmental variation

    • Development should be monitored from ~20% to 90% of embryonic timeline

    • Gas composition must be continuously monitored using oxygen analyzers

  • Comparative physiological measurements:

    • Mitochondrial respiration states (LEAK, OXPHOS, ETS) should be assessed using high-resolution respirometry

    • Enzymatic activities of electron transport chain complexes measured spectrophotometrically

    • Respiratory control ratios calculated to determine mitochondrial efficiency

  • Molecular analyses:

    • qPCR for MT-ND3 expression quantification

    • ARMS-PCR for sensitive detection of potential MT-ND3 variants

    • Next-generation sequencing to identify novel variants

  • Long-term developmental studies:

    • Animals from different environmental conditions can be raised post-hatching under standardized conditions

    • Periodic sampling to assess persistent effects on mitochondrial function

    • Correlate early-life environmental exposure with long-term phenotypic outcomes

How can I utilize allotopic expression techniques to study Alligator mississippiensis MT-ND3 function?

Allotopic expression (expressing mitochondrial genes from the nuclear genome) provides powerful tools for MT-ND3 research:

  • Construct design considerations:

    • Complete codon optimization is required to convert mitochondrial genetic code to standard nuclear code

    • Addition of a mitochondrial targeting sequence (commonly from SOD2 or COX8)

    • Optimization of start codon from ATA to ATG

    • Addition of a terminal polyadenylation signal

  • Implementation protocol:

    • Clone optimized MT-ND3 sequence into a nuclear expression vector

    • Transfect target cells using appropriate methods (lipofection, electroporation)

    • Verify mitochondrial localization using subcellular fractionation, immunofluorescence, or reporter tags

    • Assess integration into Complex I through functional and structural tests

  • Validation approaches:

    • RNase treatment of isolated mitochondria to remove surface-bound RNA

    • RT-PCR to verify presence of recombinant transcript in mitochondria

    • Quantification of mutation rates using ARMS-PCR

    • Functional rescue assessment through ATP production measurements and complex I activity assays

What bioinformatic tools are most effective for comparative analysis of MT-ND3 across Crocodilian species?

Comparative genomic analysis of MT-ND3 across Crocodilians requires specialized bioinformatic approaches:

  • Sequence acquisition and alignment:

    • Complete mitochondrial genomes should be retrieved from databases (GenBank, Ensembl)

    • MUSCLE or MAFFT alignments with crocodilian-specific gap penalty optimization

    • Manual curation of alignments focusing on MT-ND3 coding regions and flanking sequences

  • Evolutionary analysis tools:

    • PAML for selection analysis (dN/dS ratios)

    • MrBayes or RAxML for phylogenetic tree construction

    • FEL, MEME, or FUBAR for detecting sites under episodic or pervasive selection

  • Structural prediction and comparison:

    • AlphaFold or RoseTTAFold for protein structure prediction

    • SWISS-MODEL for homology modeling based on available structures

    • PyMOL or UCSF Chimera for structural visualization and comparison

  • Codon usage analysis:

    • CodonW or GCUA for codon adaptation index calculation

    • ENCprime for effective number of codons analysis

    • ICU for intrinsic codon usage bias assessment

The analysis should include at minimum Alligator mississippiensis, Alligator sinensis, Crocodylus species, and Gavialis gangeticus for comprehensive evolutionary context .

Why might recombinant Alligator mississippiensis MT-ND3 fail to properly integrate into Complex I?

Integration failures can stem from multiple factors:

  • Sequence-related issues:

    • Incomplete or improper codon optimization for the expression system

    • Missing or altered post-translational modification sites

    • Incorrect start/stop codons or reading frame errors

  • Processing problems:

    • Insufficient mitochondrial targeting sequence efficiency

    • Improper protein folding in the cytosol before import

    • Degradation during mitochondrial import process

  • Assembly barriers:

    • Absence of necessary assembly factors specific to Alligator mitochondria

    • Incompatibility with other Complex I subunits in the model system

    • Temporal dysregulation of assembly process

  • Methodological approach:

    • Analyze protein expression via western blotting

    • Verify mitochondrial localization with subcellular fractionation

    • Assess Complex I assembly using Blue Native PAGE

    • Measure enzyme activity with spectrophotometric assays

How can I distinguish between endogenous and recombinant MT-ND3 in experimental systems?

Several strategies can effectively differentiate between endogenous and recombinant MT-ND3:

  • Epitope tagging approaches:

    • Addition of small epitope tags (HA, FLAG, His) to the recombinant protein

    • Use of tag-specific antibodies for detection

    • Consideration of tag position to minimize functional interference

  • Sequence-based discrimination:

    • Introduction of synonymous mutations creating unique restriction sites

    • Design of sequence-specific primers for PCR-based detection

    • ARMS-PCR technique for quantitative assessment of mutation rates

  • Expression system selection:

    • Use of MT-ND3 knockout/null cell lines as backgrounds

    • Heterologous expression in systems with divergent endogenous MT-ND3

    • Xenomitochondrial cybrid approaches

  • Analytical techniques:

    • Mass spectrometry to detect specific peptide sequences unique to recombinant protein

    • Immunoprecipitation with tag-specific antibodies followed by functional assays

    • Blue Native PAGE with western blotting to assess incorporation into Complex I

What are the typical challenges in measuring the activity of recombinant MT-ND3 in isolated mitochondria?

Activity measurements face several technical challenges:

  • Isolation and purity issues:

    • Contamination with non-mitochondrial membranes

    • Damage to mitochondrial membranes during isolation

    • Requirement for RNase treatment to remove surface-bound nucleic acids

    • Need for intact mitochondria for reliable functional assays

  • Assay considerations:

    • Selection of appropriate substrates for Alligator-specific enzymes

    • Temperature optimization for ectotherm-derived mitochondria

    • Standardization of measurements across samples

  • Interference factors:

    • Endogenous Complex I activity masking recombinant contribution

    • Compensation by alternative NADH dehydrogenases

    • Background from partially assembled complexes

  • Data interpretation challenges:

    • Distinguishing between assembly vs. catalytic activity effects

    • Accounting for variable incorporation rates of recombinant protein

    • Normalizing activity to complex abundance rather than protein amount

Recommended approach: Combine multiple measurements including NADH:ubiquinone oxidoreductase activity, oxygen consumption rates, and ATP synthesis capacity, normalizing to Complex I content determined by Blue Native PAGE or western blotting .

How might comparative studies of MT-ND3 across vertebrates inform our understanding of mitochondrial evolution?

Comparative evolutionary studies offer several promising research avenues:

  • Adaptive evolution analysis:

    • Identification of positively selected sites in MT-ND3 across vertebrate lineages

    • Correlation of molecular changes with ecological transitions (aquatic/terrestrial)

    • Assessment of convergent evolution in lineages with similar metabolic demands

  • Structure-function relationship mapping:

    • Identification of conserved functional domains across diverse vertebrates

    • Correlation of variable regions with lineage-specific metabolic adaptations

    • Integration of structural models with functional data across species

  • Experimental approaches:

    • Creation of chimeric MT-ND3 proteins combining domains from different species

    • Xenomitochondrial cybrid cells expressing alligator MT-ND3 in mammalian backgrounds

    • Thermodynamic and kinetic characterization of MT-ND3 variants from species adapted to different thermal environments

  • Developmental plasticity investigations:

    • Comparative analysis of embryonic responses to environmental stressors

    • Assessment of epigenetic regulation of MT-ND3 across vertebrate lineages

    • Long-term studies of developmental plasticity effects on mitochondrial function

What therapeutic applications might emerge from studying recombinant Alligator mississippiensis MT-ND3?

Research on alligator MT-ND3 may inform several therapeutic applications:

  • Mitochondrial disease interventions:

    • Development of allotopic expression strategies for human MT-ND3 mutations

    • Identification of critical residues that could be targets for small molecule therapies

    • Understanding of assembly mechanisms that might be leveraged for therapeutic benefit

  • Environmental adaptation applications:

    • Insights into hypoxia tolerance mechanisms relevant to ischemic conditions

    • Understanding of developmental plasticity that may inform prenatal interventions

    • Identification of factors promoting mitochondrial efficiency under stress conditions

  • Biotechnological approaches:

    • Design of optimized mitochondrial targeting sequences based on cross-species comparison

    • Development of improved codon optimization strategies for mitochondrial gene therapy

    • Creation of novel regulatory elements for controlled expression of recombinant mitochondrial proteins

  • Experimental therapy models:

    • Testing of mitochondrial delivery methods using recombinant systems

    • Validation of gene therapy approaches for mitochondrial diseases

    • Development of cellular models for high-throughput drug screening

How might CRISPR/Cas9 technologies be applied to study MT-ND3 function in Alligator mississippiensis?

CRISPR/Cas9 approaches offer several innovative research strategies:

  • Mitochondrial genome editing:

    • Development of mitochondrially-targeted CRISPR systems

    • Introduction of specific mutations to match human disease variants

    • Creation of MT-ND3 knockout models to study complex assembly

  • Nuclear-encoded regulators targeting:

    • Identification and modification of nuclear genes affecting MT-ND3 expression

    • Manipulation of assembly factors specific to Complex I

    • Alteration of mitochondrial import machinery components

  • Reporter systems:

    • Integration of fluorescent reporters for tracking MT-ND3 expression

    • Development of split reporter systems to monitor protein-protein interactions

    • Creation of biosensors for real-time monitoring of Complex I activity

  • Methodological considerations:

    • Delivery methods appropriate for alligator cells or embryos

    • Verification strategies for mitochondrial genome modifications

    • Off-target effect assessment in the nuclear and mitochondrial genomes

These approaches require careful design of guide RNAs specific to alligator sequences and may benefit from the development of Alligator-derived cell lines for initial testing before moving to embryo-based studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.