Recombinant Allochromatium vinosum Cytochrome c1 (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
petC; Alvin_0070; Cytochrome c1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-244
Protein Length
Full Length of Mature Protein
Species
Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum)
Target Names
petC
Target Protein Sequence
SGGGEHLESANIDLRDQASLQRGAKYFMNYCTGCHSLQYMRYNRLAKDLGIDEIALRQNL LFGDAKPGDLITKAMTDDDALKWFGVVPPDLTLVTRWRSPDWVYTYLKSFYLDDTRPYGV NNVLFPLVGMPHVLGDLQGRQEAVMEPSHEPGGEPTIKGVKLVEEGGLSPQEYDTMVRDI TNFLTYAGEPFQLERERIGRYVLLFLGFLFILAYLLKKEYWKDVH
Uniprot No.

Target Background

Function
Recombinant *Allochromatium vinosum* Cytochrome c1 (petC) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex). This complex is part of the respiratory chain, generating an electrochemical potential essential for ATP synthesis. Cytochrome c1 functions as an electron donor to cytochrome c.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Allochromatium vinosum and why is its cytochrome c1 important for research?

Allochromatium vinosum (formerly Chromatium vinosum) is a well-studied photosynthetic purple sulfur bacterium that serves as a model organism for studying oxidative sulfur metabolism . Its cytochrome c1 (encoded by the petC gene) is a critical component of the bacterial cytochrome bc1 complex involved in photosynthetic and respiratory electron transport chains. This protein is particularly valuable for research because of its role in energy transduction processes and its unique structural and functional properties that allow A. vinosum to adapt to various environmental conditions .

How does cytochrome c1 function within the photosynthetic apparatus of A. vinosum?

In A. vinosum, cytochrome c1 functions as an electron carrier within the cytochrome bc1 complex, which is part of the cyclic electron transport chain crucial for photosynthesis. During photosynthetic growth, cytochrome c1 receives electrons from the Rieske iron-sulfur protein and transfers them to cytochrome c2 or other electron acceptors . This electron transfer generates a proton gradient across the membrane that drives ATP synthesis. The protein's ability to efficiently transfer electrons depends on its proper folding, heme incorporation, and optimal positioning within the membrane complex, all of which are carefully regulated during the maturation process.

What are the established protocols for recombinant expression of A. vinosum cytochrome c1?

The recombinant expression of A. vinosum cytochrome c1 typically involves cloning the petC gene into an appropriate expression vector for heterologous expression. Based on established methodologies for similar c-type cytochromes, the process includes:

  • PCR amplification of the petC gene from A. vinosum genomic DNA

  • Insertion into an expression vector (such as pET derivatives for E. coli expression)

  • Co-expression with the cytochrome c maturation (Ccm) system

  • Induction under optimized conditions (temperature, inducer concentration, duration)

For functional expression, it's critical to ensure proper trafficking of the protein to the membrane and correct incorporation of the heme group, which may require co-expression with the complete set of Ccm proteins (CcmABCDEFGHI) that facilitate heme attachment to the CXXCH motif .

What purification strategies yield the highest purity and activity of recombinant cytochrome c1?

Purification of recombinant A. vinosum cytochrome c1 typically employs a multi-step approach:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Nickel-affinity chromatography (for His-tagged constructs)

  • Ion-exchange chromatography for further purification

  • Size-exclusion chromatography as a final polishing step

The purification protocol should be performed under conditions that preserve the native conformation and heme environment. Monitoring the characteristic absorption spectrum (α, β, and Soret bands) throughout purification helps assess protein integrity and heme incorporation. The purity can be verified using SDS-PAGE analysis, while activity can be determined through spectroscopic redox assays or direct electron transfer measurements .

How can researchers verify successful expression and proper folding of recombinant cytochrome c1?

Verification of properly expressed and folded recombinant cytochrome c1 involves multiple complementary approaches:

  • Spectroscopic analysis: UV-visible absorption spectroscopy showing characteristic peaks (Soret band at ~410 nm, α and β bands at ~550 and ~520 nm)

  • Heme content quantification: Pyridine hemochrome assay to determine the ratio of heme to protein

  • SDS-PAGE with heme staining: TMBZ (3,3',5,5'-tetramethylbenzidine) staining to detect covalently bound heme

  • Mass spectrometry: To confirm the molecular weight and presence of post-translational modifications

  • Circular dichroism: To assess secondary structure content and protein folding

Additionally, functional assays measuring electron transfer activity can confirm that the recombinant protein has adopted its native conformation with properly incorporated heme.

Which amino acid residues are critical for cytochrome c1 function in A. vinosum?

Several key amino acid residues are essential for the proper function of cytochrome c1 in A. vinosum:

  • Heme-binding motif: The CXXCH motif (containing Cys-34 and Cys-37) is absolutely critical for covalent heme attachment and function

  • Disulfide bond residues: While not essential for maturation, Cys-144 and Cys-167 form a disulfide bond that influences the redox potential

  • Heme environment residues: Residues surrounding the heme, such as A181 (which can be mutated to threonine to restore function in disulfide-less variants), modulate the electron transfer properties

  • Interface residues: Amino acids at the interaction interface with partner proteins (like the Rieske protein and cytochrome c2) are important for proper electron transfer

Mutational studies have demonstrated that substitution of the disulfide-forming cysteines (C144A/C167A) affects the redox potential but can be compensated by the A181T mutation, resulting in a fully functional cytochrome c1 variant .

How do mutations in the disulfide bond affect cytochrome c1 structure and function?

Mutations in the disulfide bond-forming cysteines (C144A and C167A) of cytochrome c1 have significant effects:

ParameterWild-type cytochrome c1Disulfide-less variant (C144A/C167A)Compensated variant (C144A/C167A/A181T)
Redox potentialHigherLowerRestored to near wild-type
Structural stabilityHigherReducedImproved
Electron transfer efficiencyOptimalReducedRestored
FunctionalityFully functionalNon-functionalFully functional

The disulfide bond provides structural stability and influences the local environment around the heme, affecting its redox properties. The A181T mutation in the heme environment compensates for the absence of the disulfide bond by altering the heme pocket configuration, thus restoring functionality . This demonstrates the adaptability of the protein structure and the existence of multiple mechanisms to maintain proper electron transfer capabilities.

What strategies can be employed to engineer cytochrome c1 with modified redox properties?

Several strategies can be employed to engineer A. vinosum cytochrome c1 with modified redox properties:

  • Targeted mutagenesis of heme environment residues: Substitutions of residues near the heme can alter its electronic properties, as demonstrated by the A181T mutation

  • Modification of the disulfide bond: Manipulating Cys-144 and Cys-167 affects the redox potential, with potential for fine-tuning through various substitutions

  • Alteration of axial ligands: Changing the histidine axial ligand or introducing novel coordinating residues can significantly shift the redox potential

  • Introduction of charged residues: Adding or removing charged amino acids near the heme can adjust electrostatic interactions that influence redox behavior

  • Chimeric approaches: Creating fusion proteins with domains from other cytochromes with desired properties

How does the cytochrome c maturation (Ccm) system process cytochrome c1 in A. vinosum?

A. vinosum employs the cytochrome c maturation (Ccm) System I to process cytochrome c1, involving a complex of nine membrane proteins (CcmABCDEFGHI) . The process follows these steps:

  • Synthesis and secretion of apocytochrome c1 across the cytoplasmic membrane

  • Maintenance of reduced thiols in the CXXCH motif by the CcmG/DsbD system

  • Chaperoning of apocytochrome c1 by CcmI, which has a very high binding affinity for class I c-type apocytochromes

  • Delivery of heme to the site via the heme chaperone CcmE, which binds heme covalently at its vinyl-2 group

  • Coordination of heme iron by the histidine residue in the CXXCH motif

  • Formation of thioether bonds between the heme vinyl groups and the cysteine residues by CcmF and CcmH

  • Release of mature cytochrome c1 when heme attachment is complete, facilitated by the decreased affinity of CcmI for the heme-containing cytochrome

This highly orchestrated process ensures proper folding and cofactor incorporation, which are essential for the function of cytochrome c1 in electron transfer chains.

What is the role of CcmI chaperone in cytochrome c1 maturation?

CcmI serves as a crucial chaperone in the maturation of cytochrome c1, with several specific functions:

  • High-affinity binding: CcmI exhibits remarkably high binding affinity for class I c-type apocytochromes, including apocytochrome c1, with dissociation constants (KD) in the nanomolar range

  • Holding function: It holds the apocytochrome in an appropriate conformation for interaction with other Ccm components

  • Heme-sensitive binding: The binding affinity of CcmI for apocytochromes decreases dramatically in the presence of heme, suggesting it releases the cytochrome once heme coordination occurs

  • Specificity determination: CcmI contains TPR domains (particularly in the CcmI-2 domain) that recognize specific features of different c-type apocytochromes

This chaperone function is critical because it prevents premature folding or aggregation of the apocytochrome and positions it correctly for the precise process of heme attachment, ensuring high fidelity in cytochrome c maturation .

How do mutations in the CXXCH motif affect the maturation of cytochrome c1?

Mutations in the CXXCH heme-binding motif of cytochrome c1 have profound effects on its maturation:

Mutation typeEffect on heme attachmentEffect on CcmI bindingFunctional outcome
C→S at position 34 or 37Prevents thioether bond formationMaintains bindingNon-functional protein
XX mutationsMay alter positioning of cysteinesVariable effects depending on substitutionPotentially reduced maturation efficiency
H→X at axial ligand positionPrevents proper heme coordinationMay maintain bindingNon-functional protein

Complete elimination of both cysteine residues (e.g., C34S/C37S) prevents all heme attachment, yielding a non-functional apoprotein that cannot participate in electron transfer . Interestingly, while these mutations block maturation, they do not necessarily prevent binding to the CcmI chaperone, which continues to recognize and hold the mutated apocytochrome. This observation highlights the separate recognition mechanisms for protein-protein interaction versus the chemical requirements for heme attachment.

What spectroscopic techniques are most informative for analyzing cytochrome c1 properties?

Several spectroscopic techniques provide valuable information about A. vinosum cytochrome c1:

  • UV-visible absorption spectroscopy: Reveals characteristic peaks (Soret, α, and β bands) that indicate heme incorporation and oxidation state

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure and protein folding

  • Electron paramagnetic resonance (EPR): Detects paramagnetic species, useful for studying the heme iron in different oxidation states

  • Resonance Raman spectroscopy: Gives detailed information about the heme environment and axial ligation

  • Magnetic circular dichroism (MCD): Provides insights into the electronic structure of the heme

  • Fourier transform infrared spectroscopy (FTIR): Can detect subtle changes in protein conformation

  • Nuclear magnetic resonance (NMR): For structural studies of specific regions or in combination with isotope labeling

For functional studies, techniques such as spectroelectrochemistry can determine redox potentials, while femtosecond transient absorption spectroscopy can measure electron transfer kinetics, similar to approaches used for light-harvesting complexes in A. vinosum .

How can researchers accurately measure electron transfer rates involving cytochrome c1?

Accurate measurement of electron transfer rates involving cytochrome c1 can be accomplished through several complementary approaches:

  • Stopped-flow spectroscopy: Monitors changes in the absorption spectrum of cytochrome c1 during rapid mixing with electron donors or acceptors

  • Flash photolysis: Uses laser pulses to initiate electron transfer, followed by time-resolved spectroscopic detection

  • Protein film voltammetry: Immobilizes cytochrome c1 on an electrode surface to measure direct electron transfer kinetics

  • Transient absorption spectroscopy: Particularly useful for measuring femtosecond to nanosecond electron transfer events in photosynthetic systems

  • Pulse radiolysis: Generates reducing or oxidizing species that react with cytochrome c1 with subsequent spectroscopic monitoring

Analysis of electron transfer kinetics typically employs multi-exponential fitting models to extract rate constants for individual steps. For example, in A. vinosum photosynthetic membranes, forward and backward rate constants for electron transfer have been determined using target analysis of broadband femtosecond transient absorption spectroscopy data .

What protein-protein interaction methods are appropriate for studying cytochrome c1 binding partners?

Several methods are particularly well-suited for investigating cytochrome c1 interactions with binding partners:

  • Biolayer interferometry: Allows real-time measurement of binding kinetics and has been successfully used to determine the binding affinity (KD) between CcmI and various c-type apocytochromes

  • Surface plasmon resonance (SPR): Provides label-free detection of binding interactions with accurate kinetic parameters

  • Isothermal titration calorimetry (ITC): Measures thermodynamic parameters of binding interactions

  • Co-immunoprecipitation: Identifies in vivo interaction partners

  • Yeast two-hybrid or bacterial two-hybrid assays: For screening potential interaction partners

  • Förster resonance energy transfer (FRET): For monitoring interactions in real-time or in living cells

  • Chemical cross-linking coupled with mass spectrometry: Identifies specific interaction interfaces

For studying interactions between cytochrome c1 and other components of the electron transport chain, these methods can reveal binding affinities, kinetics, and the structural determinants of protein-protein recognition, providing insights into the mechanisms of electron transfer in A. vinosum.

How do different growth conditions affect the expression of cytochrome c1 in native A. vinosum?

The expression of cytochrome c1 in A. vinosum is significantly influenced by growth conditions:

Growth conditionEffect on cytochrome c1 expressionPhysiological relevance
Light intensityModulated expression levelsAdaptation to photosynthetic needs
Sulfur source (sulfide, thiosulfate, sulfite, elemental sulfur)Differential expression patternsMetabolic adaptation to available electron donors
Oxygen levelsRegulated expressionSwitch between photosynthetic and respiratory metabolism
Carbon source (autotrophic vs. heterotrophic)Altered expression profilesAdaptation to energy generation mode
TemperatureModified expression levelsEnvironmental adaptation

A. vinosum cells can be cultivated photolithoautotrophically in batch culture at 30°C under anaerobic conditions with continuous illumination, using modified Pfennig's medium with various sulfur sources . For photoorganoheterotrophic growth, malate (22 mM) can be used with sulfate as the sulfur source . These different growth conditions trigger specific regulatory mechanisms that optimize the expression of electron transport chain components, including cytochrome c1, to meet the metabolic demands of the cell.

What are the optimal conditions for heterologous expression of functional A. vinosum cytochrome c1?

For heterologous expression of functional A. vinosum cytochrome c1, several key conditions must be optimized:

  • Host selection: E. coli strains engineered to express the complete Ccm system (e.g., E. coli JM109 or C43(DE3) with pEC86 plasmid encoding ccmABCDEFGH)

  • Expression vector: Low to moderate copy number vectors with tunable promoters (e.g., pET derivatives with T7 promoter)

  • Induction conditions:

    • Temperature: 25-30°C (lower temperatures often improve folding)

    • IPTG concentration: 0.1-0.5 mM (lower concentrations favor proper folding)

    • Induction duration: 16-24 hours (extended time for complete maturation)

  • Media supplementation:

    • δ-aminolevulinic acid (ALA): 100-500 μM (heme precursor)

    • Iron source: 100 μM ferric citrate

    • Rich media components: for enhanced protein expression

  • Oxygen regulation: Microaerobic conditions often improve cytochrome c maturation

These optimized conditions aim to balance protein expression rates with the capacity of the Ccm system to process the apocytochrome, ensuring maximal yield of correctly folded and heme-containing cytochrome c1.

How can researchers troubleshoot low yields or improper folding of recombinant cytochrome c1?

When facing challenges with recombinant cytochrome c1 expression, researchers can employ these troubleshooting strategies:

  • For low expression yields:

    • Optimize codon usage for the host organism

    • Test different promoter strengths

    • Evaluate signal sequence efficiency for membrane targeting

    • Adjust cell density at induction

    • Consider co-expression with molecular chaperones

  • For improper folding/heme incorporation:

    • Verify complete functionality of the Ccm system

    • Increase heme availability through ALA supplementation

    • Reduce expression rate to match Ccm processing capacity

    • Adjust growth temperature and aeration conditions

    • Test fusion partners that may enhance solubility

  • Analytical approaches for problem identification:

    • Compare UV-visible spectra with native protein to assess heme incorporation

    • Use SDS-PAGE with heme staining to determine proportion of holo-protein

    • Employ mass spectrometry to identify specific defects in post-translational modifications

    • Check for accumulation of apocytochrome using immunoblotting

Systematic application of these approaches, with careful monitoring of each step in the expression and purification process, can lead to significant improvements in the yield and quality of recombinant cytochrome c1.

How can A. vinosum cytochrome c1 be utilized in artificial photosynthetic systems?

A. vinosum cytochrome c1 holds significant potential for artificial photosynthetic systems through several applications:

  • Electrode modification: Immobilization of cytochrome c1 on electrode surfaces can create bio-electrochemical interfaces for light-driven electron transfer

  • Biohybrid solar cells: Integration with light-harvesting molecules and semiconductor materials to convert light energy to electrical current

  • Redox mediator: Serving as an efficient electron carrier between photosensitizers and catalytic centers in synthetic systems

  • Model system: Providing insights for designing synthetic electron transfer proteins with optimal redox properties

The natural adaptability of A. vinosum to various light conditions makes its cytochrome c1 particularly interesting for artificial systems . The protein's well-understood structure-function relationships and the ability to engineer its redox properties through targeted mutations provide a versatile platform for designing components of artificial photosynthetic devices with tunable electron transfer characteristics.

What insights does A. vinosum cytochrome c1 provide for understanding electron transport chain evolution?

A. vinosum cytochrome c1 offers valuable insights into electron transport chain evolution:

  • Adaptive versatility: The ability of A. vinosum to thrive in various environmental conditions reflects evolutionary adaptations in its electron transport components, including cytochrome c1

  • Structural conservation and variation: Comparison with cytochrome c1 from other species reveals conserved functional domains alongside species-specific adaptations

  • Ccm system complexity: The elaborate cytochrome c maturation system in A. vinosum (System I) represents a sophisticated evolutionary solution for cofactor attachment

  • Environmental adaptation: The regulation of cytochrome c1 expression under different growth conditions demonstrates evolved mechanisms for optimizing energy conversion efficiency

Studying the unique features of A. vinosum cytochrome c1, such as its disulfide bond and compensatory mutations like A181T , provides windows into the evolutionary processes that have shaped electron transport proteins across diverse photosynthetic and respiratory systems.

How do the properties of A. vinosum cytochrome c1 compare with those from other photosynthetic bacteria?

Comparative analysis of A. vinosum cytochrome c1 with those from other photosynthetic bacteria reveals important differences and similarities:

CharacteristicA. vinosum cytochrome c1Rhodobacter speciesRhodopseudomonas species
Heme-binding motifCXXCHCXXCHCXXCH
Additional structural featuresDisulfide bond (Cys-144/Cys-167) Typically no disulfideVariable
Redox potentialModulated by disulfide and heme environment Generally lowerVariable
Maturation systemCcm System I (CcmABCDEFGHI) Ccm System ICcm System I
Adaptation to light conditionsHighly adaptable Moderately adaptableVariable adaptability
Interaction with Rieske proteinSpecies-specific interfaceDifferent interface architectureDifferent interface architecture

These differences reflect the diverse ecological niches occupied by these bacteria. A. vinosum, as a purple sulfur bacterium, has adapted its cytochrome c1 to function optimally in sulfur-based photolithoautotrophic metabolism , while other photosynthetic bacteria have evolved variations suited to their particular environmental and metabolic requirements. The structural and functional diversity of cytochrome c1 across species demonstrates the evolutionary plasticity of this critical electron transport component.

What are the unresolved questions regarding cytochrome c1 function in A. vinosum?

Despite significant advances, several important questions about A. vinosum cytochrome c1 remain unresolved:

  • Precise structural details: The complete three-dimensional structure of A. vinosum cytochrome c1 has not been determined, limiting our understanding of its unique functional properties

  • Regulatory mechanisms: The molecular details of how cytochrome c1 expression is regulated in response to environmental changes are incompletely understood

  • Protein-protein interaction dynamics: The dynamic nature of interactions between cytochrome c1 and its electron transfer partners during the catalytic cycle needs further elucidation

  • Post-translational modifications: Beyond disulfide bond formation, other potential modifications that might influence cytochrome c1 function remain largely unexplored

  • Integration with sulfur metabolism: The precise relationship between cytochrome c1 function and the unique sulfur metabolism of A. vinosum requires additional investigation

Addressing these questions will require integrating advanced structural biology techniques with functional analyses and systems biology approaches to fully understand the role of cytochrome c1 in A. vinosum metabolism.

What emerging technologies could advance research on A. vinosum cytochrome c1?

Several emerging technologies hold promise for advancing research on A. vinosum cytochrome c1:

  • Cryo-electron microscopy (cryo-EM): For determining high-resolution structures of cytochrome c1 within the context of the complete bc1 complex

  • Single-molecule spectroscopy: To observe real-time electron transfer events involving individual cytochrome c1 molecules

  • Advanced mass spectrometry approaches: For detailed characterization of post-translational modifications and protein-protein interactions

  • Optogenetic tools: For light-controlled manipulation of cytochrome c1 function in vivo

  • CRISPR-Cas9 genome editing: For precise genetic manipulation of A. vinosum to study cytochrome c1 function

  • Synthetic biology approaches: For creating minimal systems to study cytochrome c1 function in controlled environments

  • Quantum mechanical/molecular mechanical (QM/MM) simulations: For understanding electron transfer mechanisms at the atomic level

These technologies could provide unprecedented insights into the structural dynamics, electron transfer mechanisms, and regulatory processes involving cytochrome c1 in A. vinosum.

How might research on A. vinosum cytochrome c1 contribute to sustainable biotechnology applications?

Research on A. vinosum cytochrome c1 has significant potential to contribute to sustainable biotechnology applications:

  • Biocatalysis: Engineered cytochrome c1 variants could serve as redox catalysts for specific industrial reactions

  • Bioelectronics: Integration of cytochrome c1 into bioelectronic devices for sensing or energy conversion

  • Microbial fuel cells: Exploitation of the efficient electron transfer properties for enhanced bioelectricity generation

  • Photobioreactors: Development of improved photosynthetic systems for bioproduction of value-added compounds

  • Bioremediation: Application of A. vinosum's metabolic capabilities, including its electron transport components, for environmental cleanup of sulfur compounds

The unique adaptability of A. vinosum to different light conditions and sulfur sources, mediated in part by its electron transport chain components like cytochrome c1 , makes it a valuable model for developing biotechnologies that can function efficiently under variable environmental conditions. Fundamental research on the structure, function, and regulation of cytochrome c1 thus lays important groundwork for these sustainable biotechnology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.