Recombinant Allochromatium vinosum Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Alvin_0068; Ubiquinol-cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum)
Target Names
petA
Target Protein Sequence
MLASAGGYWPMSAQGVNKMRRRVLVAATSVVGAVGAGYALVPFVASMNPSARARAAGAPV EADISKLEPGALLRVKWRGKPVWVVHRSPEMLAALSSNDPKLVDPTSEVPQQPDYCKNPT RSIKPEYLVAIGICTHLGCSPTYRPEFGPDDLGSDWKGGFHCPCHGSRFDLAARVFKNVP APTNLVIPKHVYLNDTTILIGEDRGSA
Uniprot No.

Target Background

Function

A component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), a crucial respiratory chain complex responsible for generating the electrochemical potential driving ATP synthesis.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biological function of the Ubiquinol-cytochrome c reductase iron-sulfur subunit in Allochromatium vinosum?

The Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) in Allochromatium vinosum represents a critical component of the cytochrome bc1 complex, playing an essential role in the photosynthetic electron transport chain. This protein contains a [2Fe-2S] cluster that functions as an electron carrier, accepting electrons from ubiquinol and transferring them to subsequent components in the respiratory chain. In the context of A. vinosum, which is a purple sulfur phototrophic bacterium belonging to the Gammaproteobacteria class, this electron transfer process is particularly crucial for anoxygenic photosynthesis . The protein is encoded by the petA gene, which typically forms part of the petABC operon alongside genes for the b-type cytochrome and c1-type cytochrome that collectively constitute the functional cytochrome bc1 complex supporting photosynthetic growth .

Which expression systems have proven most effective for producing functional recombinant A. vinosum petA protein?

Several expression systems have been successfully employed for producing recombinant A. vinosum Ubiquinol-cytochrome c reductase iron-sulfur subunit, each with specific advantages:

Expression SystemAdvantagesTypical YieldPurity
E. coliHigh yield, cost-effective, rapid growthVaries by strain and conditions≥85% by SDS-PAGE
Yeast systemsEukaryotic post-translational modificationsModerate≥85% by SDS-PAGE
BaculovirusComplex folding, higher molecular weight proteinsModerate to high≥85% by SDS-PAGE
Mammalian cellsNative-like folding and modificationsLower yield≥85% by SDS-PAGE
Cell-free expressionRapid, avoids toxicity issuesLower yield≥85% by SDS-PAGE

What are the key characteristics of A. vinosum compared to other purple sulfur bacteria?

A. vinosum represents an important model organism among purple sulfur bacteria with several distinctive characteristics:

Allochromatium vinosum (formerly Chromatium vinosum) is a mesophilic purple sulfur bacterium belonging to the family Chromatiaceae. Its genome has been completely sequenced, comprising 3,669,074 bp with 3,302 protein-coding and 64 RNA genes . Unlike many other phototrophs, A. vinosum demonstrates remarkable metabolic versatility, capable of growing photolithoautotrophically, photoorganoheterotrophically, and even chemoorganoheterotrophically and chemolithoautotrophically under reduced oxygen partial pressure .

A key distinguishing feature of A. vinosum and other Chromatiaceae family members is their ability to store sulfur globules intracellularly when oxidizing sulfide or thiosulfate, which differs from the Ectothiorhodospiraceae family and green sulfur bacteria . Recent structural studies have also revealed that A. vinosum possesses calcium-binding sites in its light-harvesting complex (LH1), with six calcium ions identified bound to specific α1/β1- or α1/β3-polypeptides through a unique Ca2+-binding motif that differs from those found in related species .

What purification strategies are recommended for obtaining high-purity recombinant A. vinosum petA protein?

Based on published methodologies, the following purification strategy is recommended for recombinant A. vinosum petA protein:

  • Expression optimization: Use E. coli expression systems with appropriate vectors (such as pET22b) and optimize induction conditions (IPTG concentration, temperature, induction time) .

  • Affinity tag selection: Incorporate either a C-terminal His-tag (hexahistidine) or Strep-tag for affinity purification. Both approaches have been successfully used for recombinant proteins from A. vinosum .

  • Cell lysis protocol:

    • Standard methods as described in reference materials are effective

    • For membrane-associated proteins, inclusion of appropriate detergents may be necessary

    • Consider anaerobic conditions to maintain [2Fe-2S] cluster integrity

  • Chromatography sequence:

    • Initial capture: Affinity chromatography using Ni-NTA (for His-tagged proteins) or Strep-Tactin (for Strep-tagged proteins)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Purity assessment: SDS-PAGE analysis should confirm purity of ≥85%, which is standard for commercial preparations of such proteins .

  • Functional verification: Spectroscopic methods (UV-Vis, EPR) to confirm proper [2Fe-2S] cluster incorporation and protein folding .

How can researchers address contradictions in experimental data when characterizing the petA protein?

When addressing contradictory data in petA protein characterization, researchers should implement a systematic methodological approach:

  • Identify potential sources of experimental variability:

    • Buffer composition effects, particularly calcium concentration, which has been shown to affect spectroscopic properties of A. vinosum photosynthetic complexes

    • Detergent effects on spectroscopic measurements (small spectral shifts of 2-3 nm can be induced by detergents, potentially masking or mimicking other effects)

    • Expression system variations that may affect protein folding and [2Fe-2S] cluster incorporation

  • Implement methodological triangulation:

    • Apply multiple complementary analytical techniques (e.g., EPR spectroscopy, midpoint potential measurements, UV-visible spectroscopy)

    • Compare results across different protein preparations and expression conditions

    • Include appropriate controls from related organisms with well-characterized Rieske proteins

  • Systematic literature review approach:

    • Following methodological guidelines for systematic reviews as outlined in research literature

    • Explicitly formulating review questions based on contradictory findings

    • Searching for eligible studies using multiple databases without language restrictions

    • Extracting data using at least two independent reviewers to avoid systematic errors

  • Statistical validation:

    • Apply meta-analysis techniques to quantitatively analyze contradictory results

    • Use statistical methods to identify outliers and determine consensus values

    • Document all analytical decisions transparently per methodological guidelines

This comprehensive approach helps distinguish between genuine biological variability and methodological artifacts, leading to more reliable characterization of the petA protein.

What experimental approaches can assess the impact of calcium binding on electron transport involving the petA protein?

The unexpected discovery of calcium binding in A. vinosum light-harvesting complexes necessitates specific experimental approaches when studying electron transport involving the petA protein:

  • Spectroscopic analysis under controlled calcium conditions:

    • Measure absorption spectra with precisely controlled Ca2+ concentrations

    • Compare with Sr2+/Ca2+ exchange experiments to distinguish specific calcium effects

    • Implement FTIR difference spectroscopy with improved signal-to-noise ratio to detect subtle structural changes

  • Thermostability assessment:

    • Monitor complex stability in the presence and absence of calcium

    • Implement thermal denaturation experiments, as "a marked decrease in thermostability of its LH1–RC complex was observed upon removal of Ca2+"

    • Correlate thermostability with electron transport efficiency

  • Direct electron transfer measurements:

    • Monitor "kinetics of cytochrome photo-oxidation on intact cells" to assess functional impacts

    • Measure electron transfer rates between purified components with varied calcium concentrations

    • Employ rapid kinetic techniques (stopped-flow, flash photolysis) to resolve calcium effects on electron transfer steps

  • Structural analysis:

    • Utilize cryo-EM to examine structural changes in the cytochrome bc1 complex with/without calcium, building on the successful high-resolution (2.24 Å) structures achieved for A. vinosum LH1-RC complexes

    • Examine potential calcium-mediated interactions between the petA protein and other electron transport components

  • Genetic approaches:

    • Generate mutants affecting calcium binding sites to assess indirect effects on petA function

    • Use site-directed mutagenesis to investigate potential calcium binding sites on the petA protein itself

This integrated approach would elucidate the role of calcium in modulating electron transport involving the petA protein, an area that remains underexplored in A. vinosum research.

How does A. vinosum petA compare genetically and functionally with homologs in other photosynthetic bacteria?

Comparative analysis of A. vinosum petA with homologs from other photosynthetic bacteria reveals important evolutionary and functional relationships:

Genetic Comparison:
The petA gene in A. vinosum shows significant sequence similarity with Rieske iron-sulfur proteins from numerous other bacteria . Phylogenetic analysis places it within the larger context of photosynthetic bacteria evolution. Some photosynthetic bacteria, including Rubrivivax gelatinosus, possess multiple functional petA genes (petA1 and petA2) , suggesting gene duplication events during evolution. This pattern differs among bacterial lineages.

Functional Comparison:
Despite sequence variations, functional conservation is observed in key characteristics:

PropertyA. vinosum petAR. gelatinosus petAOther purple bacteria
[2Fe-2S] clusterPresentPresentPresent
Midpoint potentialNot directly reported+275 mV Typically +250 to +300 mV
Functional redundancyNot reportedDemonstrated (petA1/petA2) Variable
Spectroscopic propertiesCharacteristic of Rieske proteinsEPR signals typical of [2Fe-2S] Similar across species

The presence of the photosynthesis-specific electron transport components can be used to construct a "photosynthesis tree" (PS tree) that sometimes diverges from the 16S rRNA phylogeny , suggesting horizontal gene transfer has influenced the evolution of photosynthetic electron transport components, including the petA gene. This comprehensive comparison provides context for understanding the specific adaptations of A. vinosum petA within the broader evolutionary landscape of photosynthetic bacteria.

What are the most effective approaches for studying the in vivo function of petA in A. vinosum's electron transport chain?

Studying the in vivo function of petA in A. vinosum requires specialized approaches that account for its photosynthetic lifestyle and unique metabolic capabilities:

  • Genetic manipulation techniques:

    • Gene replacement strategies as demonstrated for other A. vinosum genes

    • Construction of mutants with modified or deleted petA genes

    • Complementation studies using conjugative plasmid transfer

    • Site-directed mutagenesis targeting conserved residues involved in [2Fe-2S] cluster coordination

  • Physiological characterization:

    • Growth rate measurements under different light conditions and electron donor sources

    • A. vinosum can grow with various electron donors including "hydrogen, sulfide, polysulfide, thiosulfate, sulfur and sulfite"

    • Comparative analysis of wild-type and mutant strains under standardized conditions

  • Spectroscopic monitoring:

    • Real-time monitoring of cytochrome oxidation kinetics in intact cells

    • Absorption spectroscopy to track changes in cytochrome bc1 complex functionality

    • In vivo EPR measurements to assess [2Fe-2S] cluster status

  • Transcriptomic and proteomic approaches:

    • Whole-genome transcriptional profiling similar to that employed to study sulfur metabolism in A. vinosum

    • Comparative proteomics of wild-type and petA mutants to identify compensatory responses

    • This approach has successfully identified new sulfur-related genes in A. vinosum

  • Metabolic flux analysis:

    • Tracking electron flow through the different metabolic pathways available to A. vinosum

    • Investigating how disruption of petA affects the organism's metabolic versatility, including its ability to switch between phototrophic and chemotrophic growth modes

These approaches collectively provide a comprehensive understanding of petA's role in A. vinosum's electron transport chain within its native cellular context.

What analytical techniques can determine whether recombinant A. vinosum petA contains properly inserted [2Fe-2S] clusters?

Verifying proper [2Fe-2S] cluster insertion in recombinant A. vinosum petA requires multiple complementary analytical approaches:

  • UV-Visible spectroscopy:

    • Characteristic absorption peaks at approximately 330, 460, and 560 nm indicate properly inserted [2Fe-2S] clusters

    • Absorbance ratio analysis (A460/A280) provides quantitative assessment of cluster incorporation

    • Spectral comparison with native protein or well-characterized homologs establishes benchmark

  • Electron Paramagnetic Resonance (EPR) spectroscopy:

    • EPR spectroscopy reveals "typical [2Fe-2S] signals" for properly incorporated clusters

    • Temperature-dependent measurements (typically at liquid nitrogen or liquid helium temperatures)

    • g-values characteristic of Rieske-type [2Fe-2S] clusters (approximately g = 2.02, 1.90, 1.80)

  • Redox potential measurements:

    • Determination of midpoint potential using potentiometric titrations

    • Properly incorporated [2Fe-2S] clusters in Rieske proteins typically exhibit midpoint potentials around +275 mV

    • Deviations from expected values suggest improper cluster incorporation or protein folding

  • Circular Dichroism (CD) spectroscopy:

    • Assessment of secondary structure to confirm proper protein folding

    • Characteristic CD signals in the visible region specific to [2Fe-2S] clusters

    • Comparison with native protein standards for validation

  • Functional assays:

    • Electron transfer capability testing using artificial electron donors/acceptors

    • Reconstitution experiments with other components of the electron transport chain

    • Activity comparisons with native protein preparations

  • Iron and sulfur content analysis:

    • Quantitative determination of Fe and S content by colorimetric assays or ICP-MS

    • Theoretical [2Fe-2S] cluster should yield a 1:1 Fe:S ratio

    • Deviations suggest incomplete cluster assembly or degradation

When combined, these analytical approaches provide comprehensive verification of proper [2Fe-2S] cluster incorporation, essential for functional studies of recombinant A. vinosum petA protein.

What cultivation conditions are optimal for A. vinosum strains used for petA studies?

Optimal cultivation conditions for A. vinosum strains in petA research must address the organism's specific growth requirements:

Standard cultivation protocol:
A. vinosum is typically grown phototrophically (anoxic/light) in mineral medium containing 0.34 mM CaCl2 at room temperature for 7 days under incandescent illumination at middle-light intensity (52 μmol m−2 s−1) . For comparative studies, researchers may also employ low-light intensity incandescent light (10 μmol m−2 s−1) or specific wavelength illumination using LED panels (e.g., peak wavelength emission at 850 nm) .

Key cultivation parameters:

ParameterOptimal ConditionNotes
Temperature25-35°C (optimal range) Mesophilic organism
pH7.0-7.3 (optimal range) Neutral pH preference
Light conditions52 μmol m−2 s−1 (standard) Various intensities may be used for specific studies
Medium compositionMineral medium with 0.34 mM CaCl2 Calcium concentration is important
Growth modePhototrophic (anoxic/light) Alternative growth modes possible for specific studies
Electron donorsVaries by experimentSulfide, thiosulfate, elemental sulfur, or malate
Culture vesselCompletely filled bottlesEnsures anaerobic conditions

For studies investigating calcium effects, A. vinosum can be cultured in calcium-free mineral medium, though this requires multiple subcultures for adaptation . When investigating different electron donors, the medium can be supplemented with sulfide, thiosulfate, elemental sulfur, sulfite, or malate as appropriate for the specific research question .

The cultivation approach should be standardized across experiments to ensure reproducibility, particularly when comparing wild-type and mutant strains or studying the effects of different electron donors on petA expression and function.

How can researchers design effective mutagenesis strategies for studying petA function?

Designing effective mutagenesis strategies for studying petA function in A. vinosum requires careful consideration of several factors:

  • Target selection for mutagenesis:

    • Conserved cysteine residues coordinating the [2Fe-2S] cluster

    • Residues involved in protein-protein interactions with other cytochrome bc1 complex components

    • Regions potentially involved in ubiquinol binding or electron transfer

    • Comparative sequence analysis with other Rieske proteins can identify critical residues

  • Mutagenesis methods:

    • Site-directed mutagenesis using PCR-based approaches with Pfu DNA polymerase for high fidelity

    • Cloning in E. coli vectors (such as pET22b) before transfer to A. vinosum

    • Gene replacement techniques for chromosomal integration of mutations

  • Transfer and integration strategies:

    • Conjugative plasmid transfer from E. coli to A. vinosum

    • Selection using appropriate antibiotics (kanamycin 10 μg/ml, streptomycin 50 μg/ml, or ampicillin at 10 μg/ml for solid media and 100 μg/ml for liquid media)

    • Verification of integration by PCR and Southern hybridization

  • Verification protocols:

    • PCR verification with flanking primers

    • Southern hybridization with digoxigenin-labeled probes generated by PCR

    • DNA sequencing to confirm the intended mutation

    • Western blotting to verify protein expression

  • Phenotypic analysis approaches:

    • Growth rate measurements under photosynthetic conditions

    • Spectroscopic analysis of electron transfer capabilities

    • Comparative analysis with wild-type and complemented strains

This comprehensive approach allows for systematic investigation of structure-function relationships in the petA protein within its native cellular context in A. vinosum.

What protocols ensure reproducible spectroscopic characterization of the petA protein?

Ensuring reproducible spectroscopic characterization of the petA protein requires standardized protocols addressing multiple variables:

  • Sample preparation standardization:

    • Consistent protein concentration (typically 0.1-1.0 mg/ml depending on technique)

    • Uniform buffer composition (pH, ionic strength, reducing agents)

    • Critical attention to calcium concentration (0.34 mM CaCl2 standard)

    • Controlled detergent type and concentration (important as detergents can cause 2-3 nm spectral shifts)

    • Anaerobic sample handling to prevent [2Fe-2S] cluster oxidation

  • UV-Visible spectroscopy protocol:

    • Baseline correction with matched buffer

    • Scanning parameters: 250-700 nm range, 1 nm resolution, moderate scan speed

    • Temperature control (typically 25°C)

    • Both oxidized and reduced spectra acquisition for complete characterization

    • Multiple scan averaging to improve signal-to-noise ratio

  • EPR spectroscopy guidelines:

    • Sample freezing procedure (rapid freezing in liquid nitrogen)

    • Temperature settings (typically 10-30K for [2Fe-2S] clusters)

    • Microwave power optimization to prevent saturation

    • Modulation amplitude selection to avoid signal distortion

    • Multiple scan averaging (typically 4-16 scans)

  • Redox potential measurement protocol:

    • Standard three-electrode system

    • Selection of appropriate mediators covering the expected potential range

    • Step-wise titration procedure with equilibration periods

    • Data analysis using Nernst equation fitting

  • FTIR difference spectroscopy considerations:

    • Increased acquisition numbers to improve S/N ratio for detecting subtle changes

    • Careful sample cell preparation to ensure consistent pathlength

    • Background subtraction procedures

    • Metal ion exchange experiments (Sr2+/Ca2+) with controlled conditions

  • Data processing and analysis standardization:

    • Consistent baseline correction methods

    • Standardized peak identification algorithms

    • Reference spectra comparison

    • Statistical analysis of replicate measurements

How might structural biology approaches advance our understanding of petA function in A. vinosum?

Advanced structural biology approaches offer significant potential for deepening our understanding of petA function in A. vinosum:

  • Cryo-electron microscopy (cryo-EM):

    • Building on recent success in obtaining high-resolution (2.24 Å) structures of A. vinosum LH1-RC complexes

    • Visualization of the entire cytochrome bc1 complex with petA in its native conformation

    • Investigation of structural changes during different redox states

    • Examination of protein-protein interactions within the electron transport chain

  • Integrative structural biology approaches:

    • Combining cryo-EM with complementary techniques such as X-ray crystallography, NMR, and computational modeling

    • Investigation of dynamic aspects of petA function using hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry to map interaction interfaces between petA and other components

  • Time-resolved structural studies:

    • Capturing transient conformational changes during electron transfer

    • Correlation of structural dynamics with functional states

    • Implementation of techniques such as time-resolved X-ray solution scattering or time-resolved cryo-EM

  • In-cell structural biology:

    • Development of methods to study petA structure within intact A. vinosum cells

    • Correlation of structural features with in vivo function

    • Investigation of structural adaptations under different growth conditions

  • Comparative structural analysis:

    • Structural comparison of A. vinosum petA with homologs from other photosynthetic bacteria

    • Identification of species-specific adaptations in the context of different photosynthetic mechanisms

    • Correlation of structural features with the unique metabolic versatility of A. vinosum

These approaches would significantly advance our understanding of how petA structure relates to its function in electron transfer and how this contributes to the remarkable metabolic flexibility of A. vinosum as a model organism for studying anoxygenic photosynthesis.

What emerging technologies might improve recombinant expression of A. vinosum petA?

Several emerging technologies hold promise for improving recombinant expression of functional A. vinosum petA protein:

  • Synthetic biology approaches:

    • Codon optimization specifically tailored for expression hosts

    • Design of synthetic signal sequences optimized for proper targeting

    • Implementation of modular expression systems with fine-tuned regulation

  • Advanced expression hosts:

    • Development of chassis organisms specifically engineered for iron-sulfur protein expression

    • Engineering of expression hosts with enhanced [2Fe-2S] cluster assembly machinery

    • Adaptation of photosynthetic bacteria as expression hosts for photosynthetic proteins

  • Cell-free expression system refinements:

    • Specialized cell-free systems supplemented with [2Fe-2S] cluster assembly components

    • Integration of chaperones and folding modulators specific for iron-sulfur proteins

    • Development of continuous exchange cell-free systems optimized for membrane protein expression

  • Directed evolution and machine learning applications:

    • High-throughput screening methods for identifying optimal expression constructs

    • Machine learning algorithms to predict optimal expression conditions based on protein properties

    • Directed evolution of petA variants with enhanced expression and stability characteristics

  • Nanoscale bioreactor technology:

    • Microfluidic cultivation systems with precise control of growth conditions

    • Nanoscale bioreactors enabling rapid screening of expression conditions

    • Integration with real-time monitoring of protein expression and folding

These emerging technologies could overcome current limitations in producing sufficient quantities of properly folded recombinant A. vinosum petA protein with correctly inserted [2Fe-2S] clusters, thereby accelerating research on this important component of the photosynthetic electron transport chain.

How might systems biology approaches enhance our understanding of petA in the context of A. vinosum's metabolic versatility?

Systems biology approaches offer powerful frameworks for understanding petA function within A. vinosum's remarkably versatile metabolism:

  • Multi-omics integration:

    • Building on previous transcriptomic studies that identified differential expression of 1,178 genes (30% of the A. vinosum genome) under different sulfur conditions

    • Expansion to include proteomics, metabolomics, and fluxomics data

    • Development of computational models integrating these multi-layered datasets

    • Investigation of regulatory networks governing petA expression under different growth conditions

  • Genome-scale metabolic modeling:

    • Construction of comprehensive metabolic models incorporating A. vinosum's 3,302 protein-coding genes

    • In silico simulation of electron flow through different metabolic pathways

    • Prediction of metabolic responses to perturbations in the cytochrome bc1 complex

    • Model-driven discovery of uncharacterized interactions involving petA

  • Network analysis approaches:

    • Mapping of protein-protein interaction networks centered on petA

    • Identification of functional modules and regulatory hubs

    • Correlation of network properties with phenotypic outcomes

    • Comparative network analysis across different growth conditions

  • Advanced bioinformatics for evolutionary analysis:

    • Extension of phylogenetic studies comparing "photosynthesis trees" with 16S rRNA phylogeny

    • Investigation of horizontal gene transfer events shaping cytochrome bc1 complex evolution

    • Identification of co-evolving residues within petA and between petA and interacting proteins

    • Reconstruction of the evolutionary trajectory of petA in relation to A. vinosum's metabolic capabilities

  • Integration with structural and functional data:

    • Correlation of systems-level properties with molecular mechanisms

    • Development of multi-scale models linking molecular events to cellular phenotypes

    • Identification of emergent properties not evident from reductionist approaches

These systems biology approaches would provide a holistic understanding of petA's role in A. vinosum, contextualizing molecular details within the organism's remarkable capacity to thrive under diverse environmental conditions using multiple metabolic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.