Recombinant Allpahuayo virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
273-507
Protein Length
Full Length of Mature Protein
Species
Allpahuayo mammarenavirus (isolate Rat/Peru/CLHP-2472/1997) (ALLV)
Target Names
GPC
Target Protein Sequence
GFFTWDISDSSGAHVPGGYCLEQWAIVWAGIKCFDNAVMAKCNKDHNVEFCDTMRLFDFN QNAIKTLQLNVENSVNLLKRSINGLISDSLVIRNSLKQLAKIPYCNYTKFWYVNDTITGK HSLPQCWLMRNGSYLNETHFKNEWLWESQNLYNEMLLKEYEDRQGKTPIALTDICFWSLV FFTSTVFLQLVGIPTHRHLVGEGCPKPHRITSNSLCACGYYKIPKRPTRWVRKGK
Uniprot No.

Target Background

Function

This recombinant Allpahuayo virus pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein. It mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This fusion is driven by irreversible conformational changes triggered by endosomal acidification. The stable signal peptide (SSP) is cleaved and functions as a signal peptide; it is also retained as a component of the GP complex. The SSP is essential for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent cell-cell fusion. The GPC also interacts with the host receptor.

Database Links

KEGG: vg:5848530

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the composition of the arenavirus glycoprotein complex?

The arenavirus glycoprotein complex consists of three distinct subunits: the stable signal peptide (SSP), the receptor-binding subunit GP1, and the transmembrane subunit GP2. Unlike typical signal peptides that are cleaved and discarded during protein processing, the arenavirus SSP remains associated with the mature glycoprotein complex and is critical for its function. The GP1 subunit mediates receptor recognition, while GP2 contains the fusion machinery necessary for viral entry .

What is the genomic organization of Allpahuayo virus GPC?

Allpahuayo virus is a member of the Tacaribe complex within the genus Arenavirus. Its small (S) segment is 3382 bases in length and contains two ambisense, nonoverlapping reading frames that encode the glycoprotein precursor (GPC) and the nucleocapsid protein (NP). The GPC is encoded at the 5' end of the viral S RNA in a single long ORF ranging from 1440 to 1557 nucleotides, depending on the specific arenavirus strain. Phylogenetic analysis indicates that Allpahuayo is a sister virus to Pichinde in clade A of New World arenaviruses .

How does arenavirus GPC mediate viral entry into host cells?

Arenavirus entry is initiated by the GP1 subunit's interaction with cellular receptors. For Old World arenaviruses, the primary receptor is α-dystroglycan (α-DG), while New World arenaviruses primarily use transferrin receptor 1 (TfR1). After receptor binding and internalization, acidification in endocytic vesicles triggers GP1 dissociation from the GP2-SSP complex, followed by conformational changes in GP2 that expose fusion domains. These changes, coordinated with SSP, induce fusion between viral and host membranes, delivering the viral core into the cytoplasm .

What methods are recommended for analyzing GPC processing and cell surface expression?

Based on published methodologies, a multi-faceted approach is recommended:

What regions of the GPC are essential for proper processing and function?

Several critical regions have been identified through mutational analyses:

  • SSP FLLL motif: A highly conserved motif near the C-terminus of SSP that is crucial for glycoprotein expression and maturation. Mutations in this motif significantly impact GPC processing and membrane fusion activity .

  • GP2 cytoplasmic tail (CT): Contains conserved residues essential for virus replication, particularly affecting GP processing, trafficking, assembly, and membrane fusion .

  • SSP conserved residues: Specific residues (particularly N20) play essential roles in mediating the membrane fusion reaction. Mutations at positions N20A reduce membrane fusion activity and viral virulence .

The table below summarizes key conserved residues and their functional impacts:

RegionConserved Residue(s)FunctionEffect of Mutation
SSPFLLL motifGlycoprotein expression and processingAALL mutation: defective posttranslational modifications; ALLA: reduced GP2 processing
SSPN20Membrane fusionN20A: reduced fusion activity and viral virulence
SSPN37, R55Viral virulenceMutations reduce viral virulence in vivo without affecting membrane fusion or viral growth in vitro
GP2 CTP480, R482Viral growthP480A, R482A: reduced viral growth but proper GP processing in virus-infected cells

How do mutations in the GP2 cytoplasmic tail affect viral replication?

Systematic characterization of conserved residues within the GP2 cytoplasmic tail has revealed that certain mutations (particularly P480A and R482A) significantly reduce viral growth but still permit proper GP processing in virus-infected cells. Interestingly, these mutant GPs are processed much more efficiently in virus-infected cells than in plasmid-transfected cells, suggesting differential processing mechanisms exist between these two systems .

What is the role of the stable signal peptide (SSP) in arenavirus GPC maturation?

The SSP plays multiple critical roles in arenavirus glycoprotein biology:

  • Chaperoning GPC through the secretory pathway: Without SSP, the glycoprotein precursor is retained within the endoplasmic reticulum and cannot traffic to the plasma membrane.

  • Facilitating GPC processing: SSP is required for proper cleavage of the precursor into GP1 and GP2 subunits. In its absence, processing is severely impaired.

  • Membrane fusion regulation: SSP directly participates in pH-dependent fusion during viral entry.

  • Assembly mediator: SSP interacts with the Z matrix protein, potentially facilitating incorporation of the glycoprotein into virions.

Experimental evidence indicates that a C-terminal hemagglutinin-tagged SSP (SSP-HA) can be used to investigate these functions, although the HA tag may impact some aspects of function, particularly fusion activity .

How do recombination events contribute to arenavirus evolution and pathogenicity?

Phylogenetic analyses of New World arenaviruses have revealed significant genetic divergence and evidence of recombination events, particularly within the GPC gene. Notably, Tamiami virus (TAMV) and Whitewater Arroyo virus (WWAV) appear to be derived from a single recombinant progenitor, with their GPC and NP genes segregating into different lineages when analyzed independently. The recombination junction in the GPC gene is located between amino acids 461 and 486, though the precise junction cannot be determined due to variations within this 25 amino acid window .

This finding demonstrates the capacity of bisegmented arenaviruses to exchange genetic material, potentially acquiring new pathogenic properties. For instance, by acquiring genome sequences from lineage B viruses through recombination, WWAV may have gained pathogenic potential. Further research is needed to evaluate the connection between viruses of lineage B and pathogenicity .

What are the limitations of current methods for detecting and manipulating the SSP subunit?

Detection and manipulation of the SSP present several technical challenges:

  • Limited antibody availability: Native antibodies directed against SSP that are applicable for immunofluorescence microscopy are lacking. The SP7 antibody detects SSP only under denatured and reduced conditions .

  • Size constraints: The small size of SSP (approximately 6 kDa) makes it difficult to detect using standard protein visualization methods.

  • Tags may alter function: While C-terminal hemagglutinin-tagged SSP (SSP-HA) constructs have been used to assess the significance of SSP for GPC maturation, such tags can impact certain functions. For example, the HA-tagged SSP GPC shows reduced fusion activity, limiting its potential use in recombinant virus production .

To overcome these limitations, researchers have developed specialized approaches such as using SSP-HA plasmid constructs for defining SSP membrane topology, studying pH-dependent fusion, and investigating interactions between SSP and other viral proteins .

What considerations are important when designing mutation studies in arenavirus GPC?

When designing mutation studies for arenavirus GPC, researchers should consider:

  • Expression system context: Processing of mutant GPCs may differ significantly between plasmid-based protein expression systems and viral infection. The P470A, P480A, and R482A mutant PICV GPs, for example, are processed much more efficiently in virus-infected cells than in plasmid-transfected cells .

  • Complementation studies: Evaluating whether wild-type components can rescue mutant phenotypes provides valuable insights into functional interactions. For instance, cotransfection of wild-type SSP with certain mutant GPCs can restore processing and trafficking defects .

  • Multi-level assessment: Mutations should be evaluated across multiple functional parameters, including:

    • Protein processing (cleavage of GPC into GP1 and GP2)

    • Trafficking to the cell surface

    • Membrane fusion activity

    • Viral growth in cell culture

    • Virulence in animal models

  • Conserved motif consideration: Special attention should be given to highly conserved residues or motifs across arenavirus species, as these often serve critical functions. The FLLL motif in SSP and several residues in the GP2 cytoplasmic tail represent such conserved elements with demonstrated functional importance .

What emerging approaches might advance our understanding of arenavirus GPC structure-function relationships?

Several promising approaches could enhance our understanding of arenavirus GPC:

  • Cryo-electron microscopy: To resolve high-resolution structures of the complete trimeric glycoprotein complex in different conformational states, particularly pre- and post-fusion states.

  • Reverse genetics systems: Expanding the application of systems like those developed for Pichinde virus (PICV) to study GPC mutations in the context of viral infection both in vitro and in vivo .

  • Cross-complementation studies: Investigating whether GPC components from different arenaviruses can functionally substitute for one another, potentially revealing universal vs. virus-specific mechanisms.

  • Host-pathogen interaction mapping: Identifying cellular factors that interact with specific GPC domains to facilitate processing, trafficking, and function.

How might insights from arenavirus GPC research contribute to therapeutic development?

The critical role of GPC in viral entry and the high conservation of certain domains make it an attractive target for therapeutic development against pathogenic arenaviruses. Several promising approaches include:

  • Small molecule fusion inhibitors: Targeting conserved regions of SSP or GP2 involved in the fusion process.

  • Recombinant vaccines: Using attenuated viruses with specific GPC mutations that reduce virulence while maintaining immunogenicity.

  • Monoclonal antibodies: Targeting conserved epitopes in GP1 to block receptor binding or in GP2 to prevent conformational changes required for fusion.

  • Inhibitors of GPC processing: Blocking the cellular proteases responsible for GPC cleavage into GP1 and GP2, which is essential for infectivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.