Recombinant Alouatta caraya Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Alouatta caraya (Black howler monkey)
Target Names
Target Protein Sequence
MPMQGAQRRLLGSLNSTPTATPNLGLAANHTGAPCLEVSIPHGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRASVVQQLQNTI DVLTCSSMLCSLCFLGAIAVDRYVSIFYALRYHSIVTLPRARRAIAAIWVASVLSSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQLPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLMLVVLCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELCRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor serves as a binding site for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Alouatta caraya MC1R and its biological significance?

Recombinant Alouatta caraya MC1R is a laboratory-produced version of the melanocyte-stimulating hormone receptor found in black howler monkeys (Alouatta caraya). This G-protein coupled receptor spans 317 amino acids and plays a fundamental role in regulating melanin production and pigmentation. The biological significance of this receptor lies in its evolutionary conservation across mammalian species while exhibiting species-specific variations that contribute to pigmentation diversity.

The receptor functions primarily by binding melanocortins such as alpha-melanocyte stimulating hormone (α-MSH) and adrenocorticotropic hormone (ACTH), triggering signaling cascades that regulate melanogenesis. Similar to human MC1R, it likely serves as a key regulator of pigmentation in the primate's skin and hair, though species-specific differences in function may exist . Studying this receptor provides valuable comparative data for understanding the evolution of pigmentation mechanisms across different primate lineages.

How is Recombinant Alouatta caraya MC1R typically produced for research purposes?

Recombinant Alouatta caraya MC1R is produced through heterologous expression systems, predominantly utilizing E. coli as the expression host. The production process involves cloning the full-length MC1R gene (encoding amino acids 1-317) from Alouatta caraya into a suitable expression vector that incorporates an N-terminal His-tag for subsequent purification . This expression system allows for cost-effective production of significant quantities of the receptor protein for research purposes.

The expressed protein undergoes purification typically using affinity chromatography that exploits the His-tag, followed by quality control procedures including SDS-PAGE analysis to confirm purity (generally >90%) . The final product is often prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. This production methodology aligns with standard practices for recombinant membrane receptor proteins while being optimized for the specific characteristics of MC1R.

What experimental considerations are important for reconstitution and storage?

Proper reconstitution and storage of Recombinant Alouatta caraya MC1R are critical for maintaining protein functionality. The lyophilized protein should first be briefly centrifuged to ensure all material is at the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . To prevent protein degradation during storage, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being optimal for long-term storage applications.

For storage conditions, aliquoting the reconstituted protein is essential to avoid repeated freeze-thaw cycles which can significantly compromise protein integrity. Working aliquots may be stored at 4°C for up to one week, while longer-term storage requires temperatures of -20°C or preferably -80°C . When designing experiments, researchers should account for potential activity loss during the reconstitution process and consider incorporating validation steps to confirm receptor functionality before proceeding with complex assays.

How can functional comparisons between Alouatta caraya MC1R and human MC1R be conducted?

Conducting functional comparisons between Alouatta caraya MC1R and human MC1R requires a multifaceted experimental approach. Initially, sequence alignment analysis should be performed to identify conserved domains, particularly focusing on the seven transmembrane regions and ligand-binding sites. Special attention should be paid to analogous positions of known functional human MC1R variants, such as the Arg160 position associated with red hair and pale skin in humans .

For functional studies, parallel receptor binding assays can be employed using radiolabeled or fluorescently tagged melanocortin ligands (α-MSH and ACTH) to determine comparative binding affinities and kinetics. Downstream signaling can be assessed through cAMP accumulation assays, as MC1R typically couples to Gs proteins to activate adenylyl cyclase. Heterologous expression systems such as HEK293 cells transfected with either human or Alouatta caraya MC1R constructs provide controlled environments for these comparative analyses. Additionally, chimeric receptor constructs swapping domains between human and howler monkey MC1R can help identify regions responsible for species-specific functional differences .

What methodological approaches can reveal the evolutionary significance of MC1R variants across primates?

Investigating the evolutionary significance of MC1R variants across primates requires integration of molecular evolution techniques with functional characterization. A comprehensive approach begins with phylogenetic analysis of MC1R sequences from diverse primate species, including Alouatta caraya, to identify positively selected sites and convergent evolution patterns. Calculating dN/dS ratios (nonsynonymous to synonymous substitution rates) across the phylogeny can detect signatures of selection pressure on specific codons.

Functional characterization of naturally occurring variants can be conducted through site-directed mutagenesis to recreate ancestral states or introduce variants observed in different primate lineages. The functional consequences can be assessed using cAMP signaling assays, receptor trafficking analysis, and ligand binding studies. For example, the approach used to characterize the function-altering Arg164Cys mutation in fish MC1R could be adapted to primate studies . Additionally, comparative pigmentation phenotype correlation with MC1R sequence variation across primates can reveal structure-function relationships. These data should be contextualized within ecological and environmental factors that might drive selection on pigmentation genes in different primate habitats.

How can MC1R signaling pathways be comprehensively mapped using Alouatta caraya MC1R?

Comprehensive mapping of MC1R signaling pathways using Alouatta caraya MC1R requires sophisticated experimental designs that capture both canonical and non-canonical signaling events. Initially, establish stable cell lines expressing the recombinant receptor, preferably in melanocyte-derived cells to maintain the appropriate cellular context. Canonical Gs-protein coupled adenylyl cyclase activation can be measured through real-time cAMP biosensors, while potential activation of alternative G-protein pathways (Gq, Gi) should be assessed through IP3/calcium mobilization and inhibition of forskolin-stimulated cAMP production, respectively.

For comprehensive pathway analysis, phosphoproteomic approaches can identify downstream phosphorylation cascades following receptor activation with α-MSH or ACTH. Temporal dynamics of these pathways can be captured through time-course experiments. Specific pathway components can be validated using selective inhibitors combined with siRNA knockdown approaches. Additionally, CRISPR-Cas9 genome editing to introduce tagged versions of the receptor allows for interactome studies to identify novel binding partners. Comparative analysis with human MC1R signaling would be particularly valuable for understanding primate-specific adaptations in melanocortin signaling networks . The interplay between MC1R and other pigmentation pathways, such as the inhibitory effects of agouti signaling protein (ASP) observed in human studies, should also be investigated in the context of Alouatta caraya MC1R .

What techniques can be employed to study cross-species MC1R pharmacology?

Studying cross-species MC1R pharmacology requires sophisticated techniques to examine ligand-receptor interactions across evolutionary divergent MC1R variants. Competitive binding assays using purified Recombinant Alouatta caraya MC1R can determine the affinity profiles of various melanocortin ligands (α-MSH, ACTH, β-MSH) and antagonists (agouti signaling protein). Surface plasmon resonance or isothermal titration calorimetry provides detailed thermodynamic and kinetic parameters of these interactions.

Functional responses can be quantified through species-specific receptor activation assays in heterologous expression systems. For instance, dose-response curves measuring cAMP production following stimulation with various melanocortin ligands would reveal potential differences in potency and efficacy across species. Structure-activity relationship studies using synthetic melanocortin analogs with systematic modifications can identify critical receptor-ligand interaction points that differ between species. Additionally, molecular modeling and docking simulations based on MC1R homology models can predict binding pocket differences that explain observed pharmacological variations. These comparative approaches are crucial for understanding how evolutionary pressures have shaped MC1R pharmacology across primates and provide insights into the functional convergence or divergence of melanocortin systems .

What challenges are commonly encountered when working with recombinant membrane receptors like MC1R?

Working with recombinant membrane receptors like MC1R presents several technical challenges that researchers must address. First, maintaining proper protein folding and membrane insertion during heterologous expression can be problematic, as E. coli-expressed GPCRs often aggregate in inclusion bodies. This necessitates optimization of expression conditions, including temperature, induction parameters, and possible fusion partners to enhance solubility. Purification while preserving native conformation represents another significant challenge, particularly for seven-transmembrane domain proteins like MC1R.

Additionally, functional reconstitution of purified MC1R into appropriate lipid environments is essential for activity studies but technically demanding. Researchers should consider utilizing liposomes, nanodiscs, or detergent micelles optimized for MC1R stability. Post-translational modifications present in native MC1R may be absent in bacterial expression systems, potentially affecting receptor function. Alternative expression systems (mammalian, insect cells) might be required for studies where native-like glycosylation is critical. Finally, developing robust activity assays that accurately reflect in vivo receptor function requires careful validation, particularly when comparing receptors across species like Alouatta caraya and humans . Addressing these challenges requires iterative optimization and appropriate experimental controls to ensure that observations reflect true biological properties rather than artifacts of the recombinant system.

How can researchers troubleshoot inconsistent results in MC1R functional studies?

Inconsistent results in MC1R functional studies often stem from multiple experimental variables that require systematic troubleshooting. First, verify protein quality through analytical techniques such as circular dichroism to confirm proper folding, and size-exclusion chromatography to assess aggregation state. For recombinant Alouatta caraya MC1R, batch-to-batch variation in expression and purification can significantly impact functional outcomes; therefore, implementing rigorous quality control measures for each preparation is essential.

When conducting ligand binding or signaling assays, inconsistencies may arise from degradation of ligands (particularly peptide hormones like α-MSH), which should be monitored by HPLC or mass spectrometry. The cellular context also substantially influences MC1R function; the same receptor may yield different results in various cell backgrounds due to varying levels of G proteins, arrestins, and other signaling components. Standardizing cellular models and passage numbers can reduce this variability . Additionally, receptor desensitization following repeated stimulation can confound results, necessitating carefully designed experimental timelines. Environmental factors, including temperature fluctuations, pH variations, and buffer composition, should be strictly controlled. Finally, for comparative studies between species variants, ensure that experimental conditions do not inadvertently favor one receptor variant over another by testing multiple conditions. Documenting detailed protocols and all experimental parameters facilitates troubleshooting inconsistencies and enables more reliable cross-laboratory comparisons.

What are effective strategies for validating MC1R antibodies for immunodetection techniques?

Validating antibodies for MC1R immunodetection requires a comprehensive approach to ensure specificity and reliability. Begin with positive and negative control samples: cell lines overexpressing recombinant Alouatta caraya MC1R provide positive controls, while MC1R-knockout cell lines or non-transfected parental cell lines serve as negative controls. Western blotting should demonstrate a band of appropriate molecular weight (~35-37 kDa for unmodified MC1R), with additional bands for glycosylated forms potentially present in mammalian expression systems.

How do MC1R variants in Alouatta caraya compare with known functional variants in other species?

MC1R variants across species provide fascinating insights into the evolution of pigmentation mechanisms. In Alouatta caraya, the complete MC1R sequence can be analyzed for variations that might parallel functionally significant mutations identified in other species. For example, the human R160W variant is strongly associated with red hair and pale skin phenotypes and represents a loss-of-function mutation . Researchers should examine whether Alouatta caraya MC1R contains natural polymorphisms at homologous positions and determine their functional consequences.

Studies in fish models have revealed that mutations such as the Arg164Cys substitution in cave-dwelling Astyanax populations significantly impair MC1R function, leading to depigmentation phenotypes . This position is homologous to the human R160W variant, demonstrating evolutionary conservation of functionally critical residues. Comparative analysis should include examination of transmembrane domains, which tend to be highly conserved, versus more variable extracellular loops. Additionally, population-level sequence data from Alouatta caraya individuals would reveal whether this species harbors polymorphisms similar to the extensive variation seen in human populations. Functional characterization of any identified variants through heterologous expression systems and signaling assays would establish whether parallel evolution has occurred in the melanocortin system across different mammalian lineages .

What insights can zebrafish models provide for understanding MC1R function across vertebrates?

Zebrafish models offer powerful systems for investigating MC1R function in a vertebrate context that complements studies of mammalian receptors including Alouatta caraya MC1R. Morpholino knockdown experiments in zebrafish have demonstrated that MC1R deficiency leads to reduced melanin content within melanophores, establishing a conserved role in pigmentation across vertebrate lineages . These models allow direct visualization of pigmentation phenotypes in developing embryos, providing a dynamic system to study receptor function in vivo.

A particularly valuable approach involves rescue experiments where morpholino-mediated knockdown of endogenous zebrafish MC1R is complemented with expression of MC1R variants from different species. Such studies with Astyanax (cave fish) MC1R variants revealed that certain mutations (like the 2-bp deletion in Pachón cave populations or the Arg164Cys mutation in Yerbaniz/Japonés populations) rendered the receptor non-functional, as evidenced by failure to rescue normal pigmentation . This same methodology could be applied to test Alouatta caraya MC1R function and any naturally occurring variants. Interestingly, zebrafish studies have revealed that MC1R function in teleosts extends beyond simple eumelanin/pheomelanin switching seen in mammals, affecting both pigment synthesis and distribution within melanophores . These cross-species comparative approaches highlight both conserved functions and lineage-specific adaptations in MC1R signaling across vertebrate evolution.

How can computational approaches enhance understanding of MC1R structure-function relationships?

Computational approaches offer powerful methods for exploring MC1R structure-function relationships without the limitations of experimental systems. Homology modeling of Alouatta caraya MC1R based on recently solved GPCR crystal structures can generate three-dimensional models that predict the spatial arrangement of transmembrane helices, ligand binding pockets, and intracellular signaling interfaces. These models can be refined through molecular dynamics simulations that capture receptor flexibility and conformational changes upon ligand binding.

Sequence-based evolutionary analyses, including calculation of selection pressures (dN/dS ratios) across the receptor length, can identify regions under purifying or positive selection in primate lineages. Coevolutionary analysis can detect networks of residues that have evolved together, potentially revealing functional coupling between distant parts of the receptor. Molecular docking simulations can predict binding modes of various ligands, including α-MSH and ACTH, highlighting species-specific differences in ligand recognition . Machine learning approaches incorporating data from multiple species can identify sequence patterns associated with specific functional properties. Additionally, quantum mechanical calculations can model the electronic properties of key residues involved in ligand binding or signal transduction. These computational tools, when integrated with experimental data, provide mechanistic hypotheses about how evolutionary changes in MC1R sequence translate to functional adaptations in different primate species, including Alouatta caraya.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.