Recombinant Alouatta palliata Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Alouatta palliata (Mantled howler monkey)
Target Names
Target Protein Sequence
MAHPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYVISLMLTTKLTHTSTMNAQE IEMIWTILPAIILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDS YITPTYFLEPGEFRLLEVDNRTTLPMEADIRMLISSQDVLHSWAVPSLGVKADAIPGRLN QVMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the active site (subunit 1). This binuclear center (BNC), composed of heme a3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of Cytochrome c oxidase subunit 2 (MT-CO2) in Alouatta palliata?

    Cytochrome c oxidase subunit II (COX II or MT-CO2) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), containing a dual core CuA active site that plays a significant role in physiological processes. In Alouatta palliata (mantled howler monkey), MT-CO2 functions as a critical component of the electron transport chain in cellular respiration.

    The protein features conserved regions essential for electron transfer functions, similar to those identified in other primate species. The core structure includes:

    • CuA binding domain

    • Transmembrane helices

    • Cytochrome c interaction sites

    Functional analysis demonstrates that MT-CO2 catalyzes the oxidation of substrate Cytochrome c, serving as a rate-limiting enzyme in electron transfer .

  • What expression systems are recommended for recombinant Alouatta palliata MT-CO2 production?

    Based on successful protocols for MT-CO2 from other species, the recommended expression system for Alouatta palliata MT-CO2 is E. coli. The methodology involves:

    1. Subcloning the gene into an expression vector (pET-32a or similar)

    2. Transforming into an E. coli strain optimized for expression (e.g., Transetta DE3)

    3. Inducing expression with isopropyl β-d-thiogalactopyranoside (IPTG)

    Expression Parameters:

    ParameterRecommended Condition
    E. coli strainTransetta (DE3)
    Expression vectorpET-32a with N-terminal His-tag
    IPTG concentration0.5-1.0 mM
    Induction temperature25-30°C
    Induction time4-6 hours
    Expected yield40-60 μg/mL culture

    The recombinant protein typically includes a His-tag to facilitate purification, with expected molecular mass approximately 44 kDa (including the tag) .

  • What are the optimal purification protocols for recombinant Alouatta palliata MT-CO2?

    Purification of recombinant Alouatta palliata MT-CO2 can be achieved using affinity chromatography methods. The standard protocol includes:

    1. Harvesting cells and lysing using sonication or French press

    2. Clarifying lysate by centrifugation (12,000 × g, 30 min, 4°C)

    3. Purifying using Ni(2+)-NTA agarose column chromatography

    4. Washing with increasing imidazole concentrations (20-50 mM)

    5. Eluting purified protein with 250 mM imidazole

    For optimal purity, additional purification steps may include:

    • Size exclusion chromatography

    • Ion exchange chromatography

    Final protein should be dialyzed against a suitable buffer (PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose) for stability .

Advanced Research Questions

  • How does the structure of Alouatta palliata MT-CO2 differ from other primate species, and what are the evolutionary implications?

    Comparative analysis of MT-CO2 sequences across primates reveals significant evolutionary patterns:

    Key Findings:

    • Alouatta palliata is consistently identified as the most basal taxon for the Alouatta genus in phylogenetic studies

    • Higher primates (monkeys and apes) have undergone a nearly two-fold increase in amino acid replacement rates relative to other primates

    • While functionally important amino acids are generally conserved among all primates, the acceleration in amino acid replacements in higher primates is associated with increased variation in the amino terminal end of the protein

    Evolutionary Significance:
    The replacement of two carboxyl-bearing residues (glutamate and aspartate) at positions 114 and 115 may explain poor enzyme kinetics in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals . This provides insights into how protein adaptations relate to metabolic efficiency in different primate lineages.

  • What methodologies are optimal for assessing the catalytic activity of recombinant Alouatta palliata MT-CO2?

    Evaluating the catalytic activity of recombinant MT-CO2 requires specialized techniques:

    Recommended Protocols:

    1. Spectrophotometric Assay:

      • Monitor the oxidation of reduced cytochrome c at 550 nm

      • Calculate activity as the rate of absorbance change per minute

      • Compare with native enzyme preparations as controls

    2. Polarographic Oxygen Consumption:

      • Measure oxygen consumption using a Clark-type electrode

      • Record activity as nmol O2 consumed per minute per mg protein

    3. Infrared Spectroscopy:

      • Analyze substrate-enzyme interactions

      • Detect structural changes upon substrate binding

      • Identify potential allosteric effects

    Expected Parameters for Active Enzyme:

    ParameterExpected Range
    Km for cytochrome c10-25 μM
    Vmax0.5-2.0 μmol/min/mg
    Optimal pH7.0-7.5
    Temperature optimum37-40°C
  • How can molecular docking approaches enhance our understanding of Alouatta palliata MT-CO2 function?

    Molecular docking provides valuable insights into MT-CO2 interactions with substrates and potential inhibitors:

    Methodology:

    1. Generate 3D model of Alouatta palliata MT-CO2 using homology modeling

    2. Perform energy minimization and structural validation

    3. Define binding sites based on conserved catalytic regions

    4. Dock ligands of interest using software like AutoDock or GOLD

    5. Analyze binding energies and interaction patterns

    Application Examples:

    • Studies with other MT-CO2 proteins have identified that compounds like allyl isothiocyanate (AITC) can interact with MT-CO2, forming hydrogen bonds with specific residues (e.g., a sulfur atom of AITC forming a 2.9 Å hydrogen bond with Leu-31)

    • Similar approaches can identify species-specific interactions in Alouatta palliata MT-CO2

    These computational approaches can guide site-directed mutagenesis experiments to confirm the functional importance of specific residues.

  • What are the challenges in obtaining functionally active recombinant Alouatta palliata MT-CO2, and how can they be addressed?

    Producing functionally active recombinant MT-CO2 presents several challenges:

    Common Challenges and Solutions:

    ChallengeSolution Approach
    Protein insolubilityLower induction temperature (16-20°C), use solubility-enhancing tags
    Incorrect foldingCo-express with chaperones, add detergents during purification
    Loss of cofactorsSupplement with Cu²⁺ during expression or reconstitution
    Low activityOptimize buffer conditions, ensure proper redox environment
    Tag interferenceUse TEV protease cleavage site to remove tags post-purification

    Innovative Approaches:

    • Cell-free expression systems may maintain proper folding

    • Nanodiscs or liposomes can provide membrane-like environments for proper folding

    • Directed evolution techniques can improve solubility and activity

    • Co-expression with other Cytochrome c oxidase subunits may improve folding and stability

  • How can recombinant Alouatta palliata MT-CO2 contribute to understanding primate phylogeny and evolution?

    Recombinant MT-CO2 protein can provide insights beyond sequence analysis:

    Research Applications:

    1. Functional Evolutionary Studies:

      • Compare enzyme kinetics across primate species

      • Correlate activity differences with dietary and ecological adaptations

      • Test hypotheses about metabolic adaptations in different primate lineages

    2. Structure-Function Relationships:

      • Map sequence variations to functional differences

      • Identify positive selection on specific domains

      • Correlate with habitat-specific adaptations

    Phylogenetic Insights:

    • The COX2 gene has been instrumental in establishing Alouatta palliata as the most basal taxon for the Alouatta genus

    • MT-CO2 sequence analysis supports specific phylogenetic relationships, such as the sister-group relationship between the ring-tail lemur (Lemur catta) and gentle lemurs (Hapalemur)

    • The gene shows evidence of conserved evolution through natural selection, making it valuable for understanding primate evolutionary relationships

  • How can the understanding of Alouatta palliata MT-CO2 contribute to conservation biology?

    Recombinant MT-CO2 research has implications for conservation biology:

    Applications in Conservation:

    1. Population Genetics:

      • MT-CO2 variations can serve as markers for population structure

      • Help identify evolutionarily significant units for conservation

      • Monitor genetic diversity in endangered populations

    2. Adaptation Studies:

      • Investigate metabolic adaptations to changing environments

      • Understand how dietary specialization (e.g., folivory in howler monkeys) relates to mitochondrial function

      • Predict adaptive capacity in the face of habitat degradation

    Case Study Relevance:
    Studies have shown that habitat degradation impacts gut microbiome composition in black howler monkeys (Alouatta pigra) . Similar ecological stressors may influence mitochondrial function, with MT-CO2 being a critical component for energy metabolism. By studying functional variations in this enzyme across populations in different habitat conditions, researchers can gain insights into metabolic adaptations to anthropogenic changes.

    MT-CO2 research could particularly benefit conservation efforts for the mantled howler monkey (Alouatta palliata), which faces challenges from habitat fragmentation and edge effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.