Recombinant Alouatta palliata Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Alouatta palliata (Mantled howler monkey)
Target Names
Target Protein Sequence
MPMQGAQRRLLGSLNSTPTATPNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALATRASVVQQLQNTI DVLTCSSMLCSLCFLGAIAVDRYVSIFYALRYHSIVTLPRARRAIAAIWVASVLSSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQLPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLMLVVLCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELCRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It plays a role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the regulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MC1R in Alouatta palliata compared to human MC1R?

MC1R is a trimeric G-protein-coupled receptor activated by α-melanocyte-stimulating hormone (α-MSH) . While specific structural data for Alouatta palliata MC1R is limited, comparative analysis with human MC1R suggests several conserved features:

  • Seven-transmembrane domain architecture typical of G-protein-coupled receptors

  • Extracellular N-terminus and intracellular C-terminus domains

  • Conserved binding sites for α-MSH interaction

  • Palmitoylation sites critical for receptor function and signaling

In humans, MC1R activation by α-MSH triggers the cAMP signaling pathway, promoting melanin production in melanocytes and facilitating DNA repair after ultraviolet (UV) irradiation . Research has demonstrated that MC1R plays a critical role in chromosome stability and centromere integrity in melanocytes, with α-MSH/MC1R signaling protecting melanocytes from UV radiation-induced damage .

Functional analysis comparing recombinant Alouatta palliata MC1R with human MC1R would provide insights into potential species-specific adaptations in signaling capacity and UV response mechanisms.

What experimental systems are recommended for recombinant expression of Alouatta palliata MC1R?

Successful expression of functional recombinant MC1R requires careful selection of expression systems. Based on established protocols for human MC1R, researchers should consider:

Table 1: Recommended Expression Systems for Recombinant MC1R

Expression SystemAdvantagesLimitationsRecommended Applications
HEK293 cellsNative-like post-translational modifications; established transfection protocolsModerate expression levelsFunctional assays; signaling studies
CHO cellsHigh expression yield; stable cell line generationMay alter glycosylation patternsProtein production; binding studies
Melanocyte cell linesPhysiologically relevant environment; presence of MC1R signaling machineryPotential interference from endogenous MC1RPhysiological response studies
Sf9 insect cellsHigh protein yield; suitable for large-scale productionDifferent post-translational modificationsStructural studies; protein purification

For optimal expression:

  • Use mammalian expression vectors with strong promoters (CMV, EF1α)

  • Include epitope tags (FLAG, HA) for detection and purification

  • Consider codon optimization for the host cell system

  • Incorporate appropriate signal sequences for membrane targeting

How can researchers evaluate α-MSH binding and signaling in recombinant MC1R systems?

Comprehensive evaluation of α-MSH binding and signaling requires multiple complementary approaches:

  • Binding assays:

    • Radioligand binding with [125I]-labeled α-MSH

    • Competition binding assays with unlabeled peptides

    • Time-resolved fluorescence resonance energy transfer (TR-FRET)

  • Signaling assays:

    • cAMP accumulation measurements (ELISA, FRET-based sensors)

    • Phosphorylation status of downstream effectors (CREB, ERK)

    • Gene reporter assays for MITF activation

    • Calcium mobilization assays

  • Functional readouts:

    • Melanin production in melanocytic cells

    • UV damage protection assays

    • Chromosome stability assessment

Interestingly, while MC1R typically couples to Gs proteins to increase cAMP, experimental data has shown that α-MSH can cause a reduction in cAMP levels in certain contexts, indicating potential Gi-dependent coupling . This highlights the importance of comprehensive signaling analysis when characterizing recombinant receptors from different species.

What mechanisms underlie MC1R's role in chromosome stability and how can this be studied in recombinant systems?

Research has revealed that MC1R plays a crucial role in maintaining chromosome stability and centromere integrity in melanocytes . To investigate this function in recombinant Alouatta palliata MC1R systems:

  • Metaphase spread chromosome analysis:

    • Giemsa staining to detect cytogenetic alterations

    • Telomere fluorescence in situ hybridization (FISH) for telomere integrity

    • Centromeric FISH to analyze centromeric fragmentations

    • Comparison between cells expressing wild-type versus silenced MC1R

  • Centromere integrity assessment:

    • Chromatin immunoprecipitation (ChIP) to measure binding of centromere proteins (CENP-A, CENP-C) to centromeric and pericentric DNAs

    • Analysis of α-satellite (Satα) and pericentric (Sat2) DNA binding

    • Microscopic detection of lagging chromosomes and anaphase bridges

The protective effect of α-MSH/MC1R on chromosome stability has been shown to be dependent on MC1R protein palmitoylation . Treatment with palmitoylation inhibitors like 2-bromopalmitic acid (2-BrP, 50 μM) abrogated the protective effect of α-MSH/MC1R on chromosome stability in human primary melanocytes exposed to UVB irradiation (100 J/m²) .

How does MC1R palmitoylation affect receptor function and how can this modification be assessed?

MC1R protein palmitoylation is essential for activating MC1R signaling and plays a critical role in the receptor's protective functions . To study this post-translational modification in recombinant systems:

Table 2: Methodologies for Assessing MC1R Palmitoylation

MethodPrincipleApplicationsTechnical Considerations
Metabolic labelingIncorporation of [³H]-palmitic acid or clickable analogsQuantification of palmitoylation rate; turnover studiesRequires careful handling of radioactive materials
Acyl-biotin exchange (ABE)Replacement of thioester-linked palmitate with biotinSite identification; quantitative analysisMultiple chemical steps; potential for non-specific labeling
Acyl-resin-assisted captureEnrichment of palmitoylated proteinsProteome-wide palmitoylation analysisRequires specialized resin chemistry
Site-directed mutagenesisMutation of putative palmitoylation sitesFunctional impact of specific palmitoylation eventsRequires prediction or knowledge of palmitoylation sites
Palmitoylation inhibitorsChemical inhibition of palmitoylationFunctional studies; rescue experimentsPotential off-target effects

Research has demonstrated that the protective role of MC1R in chromosome stability and centromeric integrity is palmitoylation-dependent . Exogenously activated palmitoylation of MC1R red hair color (RHC) variants may protect centromere integrity after UV radiation in melanocytes, suggesting a potential therapeutic approach for individuals with MC1R variants .

How do MC1R variants affect receptor function and signaling, and what methods can assess these differences?

MC1R variants, particularly the red hair color (RHC) variants, demonstrate altered signaling properties that affect both pigmentation and DNA repair functions:

  • Functional impact of MC1R variants:

    • Several RHC-variants (V60L, I40T, R142H, R151C, R162P, R160W, and D294H) show reduced ability to stimulate cAMP production in response to α-MSH

    • Some variants affect melanoma risk independent of pigmentation phenotype

    • Variants may show differential palmitoylation patterns

  • Methods to assess variant function:

    • Comparative cAMP signaling analysis between wild-type and variant receptors

    • Cell surface expression quantification via flow cytometry or ELISA

    • Binding affinity measurements using radioligand binding

    • UV protection assays to assess DNA repair capacity

    • Chromosome stability assessment in cells expressing variant receptors

  • Rescue strategies:

    • Exogenous activation of palmitoylation pathways

    • Chemical chaperones to improve folding of variant receptors

    • Allosteric modulators to enhance signaling efficacy

Research with human MC1R suggests that activation of MC1R palmitoylation could be a potential intervention strategy to rescue loss-of-function MC1R in RHC-variants for therapeutic benefit . Similar approaches could be explored with Alouatta palliata MC1R variants.

What role does microphthalmia-associated transcription factor (MITF) play in MC1R signaling and how can this be studied?

MITF is a critical downstream effector of MC1R signaling that mediates many of the receptor's biological effects:

  • MITF's role in MC1R signaling:

    • Mediates α-MSH/MC1R-controlled chromosome stability and centromeric integrity

    • Directly interacts with centromere protein A in melanocytes

    • Regulates melanocyte development, viability, and pigment production

    • Silencing MITF prevents α-MSH from protecting melanocytes against UV-induced chromosome instability

  • Experimental approaches:

    • ChIP assays to identify MITF binding sites in the genome

    • MITF silencing or overexpression to assess impact on MC1R-mediated functions

    • Co-immunoprecipitation to identify MITF-interacting proteins

    • Reporter gene assays to measure MITF transcriptional activity

Research has demonstrated that MITF overexpression can rescue UV radiation-induced cytogenetic alterations in melanocytes with MC1R silencing, indicating that MITF is a critical mediator of MC1R's protective effects .

How can researchers investigate cross-talk between MC1R and other melanocortin receptors in primate systems?

Melanocortin receptors (MC-R) show distinct but sometimes overlapping functions across tissues:

  • Melanocortin receptor distribution and function:

    • MC1R: primarily in melanocytes; regulates pigmentation

    • MC3R/MC4R: expressed in brain; regulate energy homeostasis

    • MC5R: expressed in multiple tissues including heart; regulates exocrine function and has cardioprotective effects

  • Methods to study receptor cross-talk:

    • Co-expression studies in recombinant systems

    • Receptor heterodimerization analysis using BRET/FRET approaches

    • Selective agonists/antagonists to isolate receptor-specific effects

    • Tissue-specific knockdown or knockout models

  • Functional readouts:

    • Signaling pathway activation (cAMP, calcium, MAPK)

    • Physiological responses in different tissues

    • Receptor trafficking and internalization patterns

Recent research has revealed unexpected roles for melanocortin receptors, such as MC5R's protection against pathological cardiac remodeling . α-MSH can activate multiple MC-R subtypes (except MC2R), suggesting potential cross-talk between different receptors in tissues where multiple subtypes are expressed .

What are the optimal conditions for expressing and purifying functional recombinant Alouatta palliata MC1R?

Successful expression and purification of functional MC1R requires careful optimization:

Table 3: Optimization Parameters for Recombinant MC1R Expression

ParameterRecommended ConditionsRationale
Expression systemHEK293 or CHO cellsProper post-translational modifications
Temperature30-32°C during expressionEnhanced folding of membrane proteins
AdditivesSodium butyrate (2-5 mM)Increases expression levels
Cholesterol (5-10 μg/ml)Improves receptor stability
α-MSH (1-10 μM)Stabilizes active receptor conformation
Detergents for extractionn-Dodecyl-β-D-maltoside (DDM)Maintains receptor structure during solubilization
Cholesteryl hemisuccinate (CHS)Stabilizes membrane proteins
Purification tagsN-terminal FLAG or His tagMinimal interference with G-protein coupling
C-terminal StrepII tagHigh-affinity purification

For optimal purification:

  • Use detergent screening to identify conditions that maintain receptor function

  • Include ligands during purification to stabilize active conformations

  • Consider lipid nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like membrane environment

  • Validate purified receptor function through ligand binding assays

What experimental design is recommended for studying MC1R's role in UV protection and DNA repair?

To investigate MC1R's protective role against UV-induced damage:

  • Cell model preparation:

    • Express wild-type or variant Alouatta palliata MC1R in melanocyte cell lines

    • Create stable MC1R knockdown and overexpression models

    • Generate cell lines expressing MC1R RHC-variants (e.g., R151C, R160W, D294H)

  • UV exposure protocol:

    • Pre-treat cells with α-MSH (10 μM) for 1-4 hours

    • Expose to UVB radiation (typically 100 J/m²)

    • Include appropriate controls (untreated, UV only, α-MSH only)

  • Endpoint assays:

    • Chromosome stability assessment using Giemsa staining and metaphase spread analysis

    • Centromeric and telomere FISH to detect specific fragmentation events

    • DNA damage markers (γH2AX, 8-oxoguanine)

    • Cell viability and apoptosis measurements

  • Mechanistic investigations:

    • Palmitoylation inhibition using 2-BrP (50 μM)

    • MITF silencing or overexpression

    • Evaluation of centromere protein binding through ChIP assays

Research has shown that α-MSH/MC1R stimulation prevents melanocytes from UV radiation-induced damage to chromosome stability and centromere integrity . This protection is dependent on both MC1R palmitoylation and MITF activity.

How can researchers investigate evolutionary conservation of MC1R function across primate species?

Comparative analysis of MC1R across primates can provide insights into evolutionary adaptations:

  • Sequence analysis approaches:

    • Multiple sequence alignment of MC1R from diverse primate species

    • Identification of conserved functional domains and variable regions

    • Prediction of post-translational modification sites

    • Analysis of selection pressure (dN/dS ratios) across receptor domains

  • Functional comparative studies:

    • Expression of MC1R from different primate species in common cellular background

    • Comparison of ligand binding affinities and signaling responses

    • Assessment of UV protection capacity across species

    • Evaluation of palmitoylation patterns and their functional significance

  • Chimeric receptor approaches:

    • Creation of domain-swapped receptors between human and Alouatta palliata MC1R

    • Identification of domains responsible for species-specific functions

    • Analysis of critical residues through site-directed mutagenesis

  • Correlation with habitat and environmental factors:

    • Analysis of MC1R sequence/function in relation to UV exposure in native habitats

    • Correlation with pigmentation patterns across primate species

    • Investigation of convergent evolution in geographically separated species

How should researchers address contradictory findings when studying recombinant MC1R function?

When encountering contradictory results in MC1R research:

  • Systematic troubleshooting approaches:

    • Verify receptor expression levels and subcellular localization

    • Confirm ligand quality and stability

    • Evaluate potential interference from endogenous receptors

    • Assess cell line-specific factors that might influence signaling

  • Reconciliation strategies:

    • Context-dependent signaling (cell type, receptor density, microenvironment)

    • Temporal dynamics (early vs. late signaling events)

    • Receptor heterogeneity (splice variants, post-translational modifications)

    • Technical differences in experimental approaches

  • Comprehensive signaling analysis:

    • Evaluate multiple signaling pathways simultaneously

    • Include both proximal (G-protein activation) and distal (gene expression) readouts

    • Consider biased signaling through different G-protein subtypes

    • Analyze concentration-dependent effects

Research has shown that α-MSH can produce unexpected signaling patterns, including potential Gi-dependent coupling that reduces cAMP levels in certain contexts , highlighting the complexity of MC1R signaling and the importance of comprehensive analysis.

What statistical approaches are recommended for analyzing MC1R functional data?

Robust statistical analysis is critical for interpreting MC1R functional data:

  • Experimental design considerations:

    • Include appropriate biological and technical replicates

    • Use paired designs when comparing wild-type and variant receptors

    • Include positive and negative controls in all experiments

    • Consider concentration-response relationships rather than single-point measurements

  • Statistical methods for common assays:

    • Dose-response curves: Nonlinear regression analysis to determine EC50/IC50 values

    • Binding data: Scatchard analysis or nonlinear curve fitting for Kd and Bmax

    • Time-course experiments: Area under the curve analysis or repeated measures ANOVA

    • Microscopy data: Quantitative image analysis with appropriate thresholding

  • Advanced statistical approaches:

    • Principal component analysis for multidimensional signaling data

    • Cluster analysis for identifying pattern similarities across variants

    • Bayesian statistical methods for integrating prior knowledge with experimental data

    • Machine learning approaches for pattern recognition in complex datasets

  • Reporting recommendations:

    • Include measures of variability (standard deviation, standard error)

    • Report exact p-values rather than significance thresholds

    • Use appropriate multiple comparison corrections

    • Present raw data alongside normalized results when possible

What emerging technologies could advance our understanding of primate MC1R function?

Several cutting-edge technologies hold promise for MC1R research:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for MC1R structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Single-molecule FRET to study receptor conformational changes

    • Computational molecular dynamics simulations of receptor-ligand interactions

  • Genome editing technologies:

    • CRISPR-Cas9 to generate precise mutations mimicking primate MC1R variants

    • Base editing for introducing specific point mutations

    • Prime editing for complex genomic modifications

    • Inducible gene expression systems for temporal control of MC1R expression

  • Advanced imaging modalities:

    • Super-resolution microscopy for subcellular localization

    • Single-molecule tracking of receptor dynamics

    • Label-free biosensors for real-time monitoring of signaling events

    • Intravital microscopy for in vivo assessment of MC1R function

  • Organoid and tissue engineering approaches:

    • Melanocyte organoids expressing recombinant MC1R variants

    • Skin-on-chip models for UV response studies

    • 3D co-culture systems with melanocytes and keratinocytes

    • Patient-derived melanocytes reprogrammed to express primate MC1R variants

How might research on Alouatta palliata MC1R contribute to our understanding of melanoma risk and prevention?

Research on primate MC1R variants could provide valuable insights for human health:

  • Evolutionary insights:

    • Identification of naturally selected MC1R adaptations in UV-exposed environments

    • Discovery of compensatory mechanisms in species with MC1R variants

    • Understanding of convergent evolution in pigmentation systems

  • Translational potential:

    • Development of MC1R-targeted interventions for melanoma prevention

    • Identification of novel pathways that could be targeted in MC1R variant carriers

    • Improved risk assessment based on functional understanding of MC1R variants

  • Therapeutic strategies:

    • Palmitoylation-enhancing compounds to rescue MC1R variant function

    • Small molecule modulators of MC1R signaling

    • MITF-targeted approaches to bypass MC1R deficiency

    • Centromere-stabilizing interventions for individuals with high UV sensitivity

Research has shown that exogenously activated palmitoylation of MC1R RHC-variants may protect centromere integrity after UV radiation in melanocytes , suggesting potential therapeutic avenues for individuals with MC1R variants associated with increased melanoma risk.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.