Recombinant Alouatta sara Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Alouatta sara (Bolivian red howler monkey)
Target Names
Target Protein Sequence
MPMQGAQRRLLGSLNSTPTATPNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLEMAVILLLEAGALATRASVVQQLQNTI DVLTCSSMLCSLCFLGAIAVDRYVSIFYALRYHSIVTLPRARRAIAAIWVASVLSSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQLPAHQGFGLRGA ATLTILLGIFFVCWGPFFLHLMLVVLCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELCRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the Melanocyte-stimulating hormone receptor (MC1R) and its primary function?

    The Melanocyte-stimulating hormone receptor (MC1R) is a G protein-coupled receptor that plays a critical role in regulating skin and hair pigmentation. It functions by binding melanocortin peptides, particularly α-melanocyte-stimulating hormone (α-MSH), which activates signaling cascades that ultimately control the production of eumelanin (black/brown pigment) versus pheomelanin (red/yellow pigment). In humans and other primates, MC1R represents one of the major genes determining skin pigmentation . The receptor's activation influences melanocyte function, with different variants affecting the receptor's signaling capacity, leading to observable phenotypic differences. The full-length protein sequence of Alouatta sara MC1R consists of 317 amino acids with specific structural domains that facilitate its membrane integration and signaling capabilities .

  • How does Alouatta sara MC1R compare structurally to human MC1R?

    Alouatta sara (Bolivian red howler monkey) MC1R shares significant sequence homology with human MC1R, though with notable differences reflecting evolutionary divergence. Based on the sequence information provided, the Alouatta sara MC1R protein contains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors . The amino acid sequence reveals conserved regions essential for ligand binding and signaling functions, including the YCFICCL motif in the transmembrane domains. While the exact percentage identity between human and Alouatta sara MC1R is not specified in the available data, comparative analysis of other proteins between these species shows moderate to high conservation. For example, other proteins like RNASE1 between primates typically show around 87-88% sequence identity . This conservation suggests functional similarities while allowing for species-specific adaptations.

  • What experimental systems are suitable for studying recombinant Alouatta sara MC1R?

    Recombinant Alouatta sara MC1R can be studied using various experimental systems, each with specific advantages for different research questions. Cell-based assays using transfected mammalian cell lines (such as HEK293 or CHO cells) represent the most common approach, allowing for functional studies of receptor activation, signaling, and ligand binding. Membrane preparations from these systems can be used in radioligand binding assays to determine binding affinities and kinetics. For structural studies, purified recombinant protein can be incorporated into nanodiscs or liposomes to maintain native conformation. ELISA-based detection systems utilizing recombinant MC1R, as referenced in commercial offerings, provide another methodological approach for detecting and quantifying MC1R interactions . When selecting an experimental system, researchers should consider whether they need to study the receptor in isolation or within a cellular context that recapitulates the native signaling environment.

Advanced Research Questions

  • How do MC1R variants affect melanoma susceptibility, and what insights might Alouatta sara MC1R provide for comparative oncology?

    MC1R variants significantly impact melanoma susceptibility through both pigmentary and non-pigmentary pathways. Research demonstrates that seven key variants (p.D84E, p.R142H, p.R151C, p.I155T, p.R160W, p.R163Q, and p.D294H) are significantly associated with melanoma development, with odds ratios ranging from 1.42 for p.R163Q to 2.45 for p.I155T . Notably, some variants like p.R160W and p.D294H associate with both red hair/fair skin phenotype and melanoma risk, while others like p.D84E, p.R142H, and p.R151C strongly associate with red hair only (odds ratios: 2.99-8.10) . This suggests MC1R influences cancer susceptibility through both pigmentation-dependent and independent mechanisms.

    Alouatta sara MC1R presents an intriguing comparative model because howler monkeys have evolved distinct genetic adaptations in response to their environment and dietary specializations . Although the available data doesn't specifically address melanoma susceptibility in these primates, the evolutionary conservation patterns in MC1R across species could reveal protective mechanisms against UV damage or alternative functional pathways. Comparative analysis of MC1R signaling between species with different melanoma susceptibility rates could identify conserved protective mechanisms or risk factors, potentially leading to novel therapeutic approaches.

  • What is the relationship between MC1R variants and CDKN2A mutations in familial melanoma settings?

    Research has established a complex interaction between MC1R variants and CDKN2A mutations in familial melanoma. CDKN2A germline mutations confer high melanoma risk, but penetrance is significantly modified by MC1R variants and phenotypic characteristics . Data from the Melanoma Genetics Consortium encompassing 815 CDKN2A mutation carriers across 186 families from 15 international centers demonstrated that carrying any of the four most frequent MC1R variants (V60L, V92M, R151C, R160W) was associated with statistically significantly increased melanoma risk (p-values ranging from 1.24×10^-6 to 0.0007) .

    A dose-dependent relationship exists, with melanoma risk increasing with the number of MC1R variants. Carriers of at least two MC1R variants had a 2.6-fold higher risk than those with only one variant (OR=5.83 [95% CI: 3.60-9.46] vs 2.25 [95% CI: 1.44-3.52]; p-trend=1.86×10^-8) . Joint analysis revealed significant associations between melanoma risk and MC1R variants (0.0001≤p≤0.04), hair color (0.006≤p≤0.06), and nevus count (6.9×10^-6≤p≤0.02) . These findings suggest a multifactorial model where genetic and phenotypic factors together influence melanoma predisposition in CDKN2A mutation carriers. The comparative study of Alouatta sara MC1R could potentially reveal how these interactions evolved and differ across primate lineages.

  • What are the methodological challenges in expressing and purifying functional recombinant Alouatta sara MC1R?

    Expressing and purifying functional recombinant Alouatta sara MC1R presents several methodological challenges inherent to membrane proteins. As a seven-transmembrane G protein-coupled receptor, MC1R requires a lipid environment to maintain native conformation and function. Researchers typically encounter difficulties with:

    • Expression systems: Mammalian expression systems (HEK293, CHO) produce properly folded protein but at lower yields, while bacterial systems offer higher yields but often with improper folding or post-translational modifications.

    • Solubilization: Extracting the receptor from membranes requires careful selection of detergents that maintain protein structure without denaturation.

    • Purification strategy: The tag type, as noted in product information, "will be determined during production process" , highlighting the empirical approach needed for each specific protein.

    • Functional assessment: Verifying that the purified receptor retains native ligand binding and signaling capabilities requires specialized assays.

    • Storage stability: The recommended storage in "Tris-based buffer, 50% glycerol" at -20°C indicates the challenges in maintaining long-term stability of the purified protein.

    Successful purification typically employs affinity chromatography via engineered tags, followed by size exclusion chromatography to ensure homogeneity. For functional studies, reconstitution into lipid nanodiscs, liposomes, or detergent micelles is often necessary to preserve activity.

Comparative Evolutionary Analysis

  • How has MC1R evolved in howler monkeys compared to other primates, and what does this tell us about environmental adaptations?

    The evolution of MC1R in howler monkeys provides insights into primate adaptation to different ecological niches. While the search results don't directly address MC1R evolution in howlers, they do reveal that these primates have undergone unique genetic adaptations related to their specialized folivorous diet. For instance, howler monkeys have experienced a duplication event in the RNASE1 gene, creating RNASE1B with amino acid substitutions parallel to those found in colobines (Old World monkeys with leaf-based diets) . This represents convergent evolution where similar selective pressures led to parallel genetic changes in distantly related primates.

    By extension, MC1R in Alouatta sara likely shows evolutionary patterns reflecting the species' habitat and UV exposure. Howler monkeys inhabit diverse forest environments across Central and South America, with varying canopy coverage and consequent UV exposure levels. Comparative sequence analysis would likely reveal selection patterns related to these ecological factors. Unlike the RNASE1 gene which shows specific adaptations for digestion, MC1R evolution would more likely reflect balances between camouflage needs, UV protection, and thermoregulation requirements in the varying forest habitats of these primates.

  • What functional differences might exist between human and Alouatta sara MC1R in terms of ligand binding and signaling?

    Functional differences between human and Alouatta sara MC1R likely exist in ligand binding affinity, signaling efficiency, and regulatory mechanisms. Based on the amino acid sequence provided for Alouatta sara MC1R, several key binding and signaling domains can be identified . The transmembrane regions contain conserved motifs important for structural integrity and ligand binding, while intracellular loops mediate G-protein coupling and downstream signaling.

    Species-specific differences might include:

    • Ligand selectivity: Variations in the binding pocket could alter affinities for different melanocortin peptides (α-MSH, β-MSH, ACTH).

    • Signaling bias: Different coupling efficiencies to various G proteins (Gs vs Gq) might result in species-specific signaling preferences.

    • Regulation sensitivity: Differences in phosphorylation sites could affect receptor desensitization and internalization rates.

    • Environmental adaptations: The receptor may be tuned to function optimally under the specific UV exposure patterns and thermal conditions of the Bolivian howler monkey's habitat.

    These functional differences would be best characterized through comparative pharmacological studies measuring dose-response relationships, signaling pathway activation, and adaptive responses to environmental stressors between the human and Alouatta sara receptors.

Methodological Protocols

  • What are the optimal conditions for studying ligand binding to recombinant Alouatta sara MC1R?

    Optimal conditions for studying ligand binding to recombinant Alouatta sara MC1R require careful attention to both receptor preparation and assay conditions. Based on standard GPCR protocols and the specific characteristics of MC1R, the following methodological approach is recommended:

    Receptor Preparation:

    • Express receptor in mammalian cells (HEK293 or CHO) to ensure proper folding and post-translational modifications

    • Prepare membrane fractions in a buffer containing 25mM Tris-HCl (pH 7.4), 5mM MgCl₂, and protease inhibitors

    • For purified receptor studies, solubilize in mild detergents (DDM or LMNG) or reconstitute into nanodiscs

    Binding Assay Conditions:

    • Temperature: 25-30°C for initial screening, but comparative studies at 37°C to mimic physiological conditions

    • Buffer composition: 50mM HEPES (pH 7.4), 1mM CaCl₂, 5mM MgCl₂, 0.2% BSA

    • Ligand considerations: Use iodinated α-MSH for classical binding studies or fluorescently labeled analogs for FRET-based approaches

    • Incubation time: 1-2 hours to reach equilibrium for most melanocortin peptides

    Data Analysis:

    • Apply appropriate binding models (one-site, two-site, or allosteric) based on preliminary results

    • Account for non-specific binding through parallel assays with excess unlabeled ligand

    • Calculate key parameters including Kd, Bmax, and Hill coefficient to characterize binding properties

    These conditions should be optimized specifically for Alouatta sara MC1R, as binding parameters may differ from those established for human MC1R due to species-specific structural differences in the ligand binding domain.

  • How can researchers effectively compare signaling pathways between human and Alouatta sara MC1R?

    Effective comparison of signaling pathways between human and Alouatta sara MC1R requires parallel experimental systems that minimize variables outside the receptor itself. A comprehensive comparative methodology would include:

    Expression System Standardization:

    • Use identical host cells (preferably HEK293 or CHO with minimal endogenous melanocortin signaling)

    • Ensure equivalent receptor expression levels through quantitative Western blotting or flow cytometry

    • Create stable cell lines with inducible expression systems for consistent receptor levels

    Signaling Pathway Analysis:

    • cAMP assays: Monitor Gs-mediated signaling using BRET-based sensors or ELISA methods

    • Calcium flux: Measure Gq coupling through fluorescent calcium indicators

    • ERK phosphorylation: Assess MAPK pathway activation kinetics and magnitude

    • β-arrestin recruitment: Quantify receptor internalization and non-G protein signaling

    Comparative Experimental Design:

    • Construct concentration-response curves (10^-12 to 10^-6 M) for multiple ligands (α-MSH, β-MSH, ACTH)

    • Determine EC50 values, maximal responses, and signal bias metrics

    • Evaluate signaling kinetics through time-course experiments (0-60 minutes)

    • Assess desensitization patterns with repeated ligand exposures

    Data Interpretation:

    • Calculate bias factors between different pathways using operational models

    • Compare species differences in context of receptor sequence variations

    • Evaluate evolutionary implications of observed signaling differences

    This methodology provides a comprehensive characterization of similarities and differences in signaling mechanisms, potentially revealing how evolutionary pressures have shaped MC1R function across primate lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.