Recombinant Alouatta seniculus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Introduction to Alouatta seniculus MC1R

The Melanocyte-stimulating hormone receptor, commonly referred to as MC1R, is a critical protein encoded by the MC1R gene in Alouatta seniculus (Red howler monkey). This receptor belongs to the family of G protein-coupled receptors that play essential roles in regulating pigmentation. MC1R functions primarily as a receptor for melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH), with its activity mediated by G proteins that activate adenylate cyclase . The recombinant form of this protein has been developed for research applications, enabling detailed investigation of its properties and functions in comparison with MC1R from other species.

In Alouatta seniculus, MC1R plays a crucial role in the regulation of melanin synthesis, specifically influencing the production of eumelanin (dark pigment) and pheomelanin (yellow-red pigment) . This regulation contributes to the characteristic coat coloration of these primates and represents an important aspect of their phenotypic evolution.

Physical and Chemical Properties

The recommended storage conditions for the recombinant protein highlight its stability requirements:

PropertySpecification
Storage BufferTris-based buffer with 50% glycerol, optimized for protein stability
Storage Temperature-20°C or -80°C for extended storage
Working Temperature4°C for up to one week
Special HandlingRepeated freeze-thaw cycles not recommended

Table 1: Storage and handling specifications for recombinant Alouatta seniculus MC1R protein

Functional Aspects of MC1R in Alouatta seniculus

The MC1R protein in Alouatta seniculus functions primarily as a receptor for melanocyte-stimulating hormone, facilitating critical signaling pathways related to pigmentation. When activated by its ligands (MSH or ACTH), MC1R triggers a signaling cascade through G protein-mediated activation of adenylate cyclase, leading to increased intracellular cyclic adenosine monophosphate (cAMP) levels .

This cAMP elevation subsequently regulates melanin synthesis through multiple downstream effects, including the upregulation of microphthalmia transcription factor, which plays a pivotal role in melanocyte differentiation and survival . This signaling pathway ultimately influences the relative production of eumelanin versus pheomelanin, thereby determining pigmentation characteristics.

Comparative Analysis with MC1R in Other Species

Comparing Alouatta seniculus MC1R with that of other primates reveals interesting evolutionary patterns. The closely related Alouatta palliata (Mantled howler monkey) has a similar MC1R protein with 317 amino acids, though with some sequence variations . Both species belong to the same genus but show subtle differences in their MC1R structures that may correlate with their distinct pigmentation patterns.

Comparison with Other Alouatta Species

The table below compares key features of MC1R between different Alouatta species based on available data:

SpeciesProtein LengthNotable FeaturesReference
Alouatta seniculus317 amino acidsFull-length protein with specific sequence variations
Alouatta palliata317 amino acidsSimilar structure but with distinct sequence variations

Table 2: Comparison of MC1R characteristics between Alouatta species

Comparison with Other Primates

Broader comparative analysis with other primate species reveals evolutionary patterns in MC1R function. Studies on macaque MC1R variants have shown that single amino acid substitutions can lead to significant functional changes . For instance, in Sulawesi macaques, species-specific MC1R variants exhibited divergent basal activity and agonist-induced cAMP performance compared to ancestral sequences .

This comparative perspective suggests that evolutionary pressures on MC1R may differ across primate lineages, potentially reflecting adaptation to different environmental conditions or selection for specific pigmentation patterns.

Research Applications and Available Forms

Recombinant Alouatta seniculus MC1R is available in various forms for research applications, enabling studies of its structure, function, and evolutionary significance.

Research Applications

The recombinant protein finds application in various research contexts:

  1. Evolutionary studies of pigmentation genetics

  2. Comparative analysis of melanocortin signaling across primate species

  3. Investigation of structure-function relationships in G protein-coupled receptors

  4. Development of antibodies and detection reagents for MC1R

  5. Studies of ligand binding and receptor activation

Evolutionary Significance of MC1R in Alouatta seniculus

The evolution of MC1R in Alouatta species represents an interesting case study in adaptive evolution. Within the context of New World monkeys, Alouatta seniculus possesses uniform trichromatic color vision, unlike many other platyrrhine primates that exhibit polymorphic color vision . This visual system may have co-evolved with coat coloration patterns regulated by MC1R, potentially reflecting adaptation to frugivory and social signaling.

Evidence from other primate species suggests that MC1R can undergo different selective pressures. For example, in Sulawesi macaques, the MC1R of species with melanism (M. nigra and M. nigrescens) showed signatures of purifying selection (ω = 0.086), indicating functional constraint . Although similar detailed selective analyses are not available specifically for Alouatta seniculus MC1R, the conservation of the full-length protein suggests functional importance.

Current Research Findings and Future Directions

Current research on MC1R in Alouatta species intersects with broader investigations of primate evolution, pigmentation genetics, and visual ecology. The uniform trichromacy in Alouatta seniculus, with photopigment peaks at approximately 430, 530, and 562 nm, provides an optimal system for detecting fruits against foliage backgrounds . This visual adaptation may have co-evolved with pigmentation patterns regulated by MC1R.

Future research directions may include:

  1. Detailed functional characterization of Alouatta seniculus MC1R, including basal and ligand-induced activity

  2. Comparative analysis of MC1R sequence variation across Alouatta populations

  3. Investigation of the relationship between MC1R variants and coat color variation

  4. Exploration of potential co-evolution between visual perception and pigmentation in howler monkeys

  5. Examination of selective pressures on MC1R in different ecological contexts

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Alouatta seniculus (Red howler monkey)
Target Names
Target Protein Sequence
MPMQGAQRRLLGSLNSIPTATPNLGLAANHTGAPCLEVSIPDWLFLSLGLVSLVQNVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILMLEAGALATRASVVQQLQNTI DVLTCSSMLCSLCFLGAIALDRYVSIFYALRYHSIVTLPRARRAIAATWVASVLSSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQLPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLMLVVLCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELCRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH, alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the modulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC1R and what is its primary function in Alouatta seniculus?

The melanocortin 1 receptor (MC1R) in Alouatta seniculus, like in other mammals, is a melanocytic G protein-coupled receptor that regulates skin pigmentation and UV responses. It functions by activating adenylyl cyclase following binding with agonistic ligands, leading to dissociation of the Gαs protein which stimulates the production of the second messenger cAMP . In red howler monkeys (Alouatta seniculus), which spend almost their entire lives in the top canopy of forests where UV exposure is significant , MC1R likely plays a crucial role in protection against UV damage through melanin regulation.

The methodological approach to studying MC1R function in Alouatta seniculus typically involves:

  • Cloning and expression of the receptor in cell culture systems

  • Functional assays measuring cAMP generation in response to melanocortin agonists

  • Comparative analysis with MC1R from other species to identify unique structural or functional properties

How does the Alouatta seniculus MC1R sequence compare to other primate species?

While specific sequence comparisons for Alouatta seniculus MC1R are not detailed in the provided research, comparative genomic approaches would be similar to those used for studying other genes in howler monkeys. For instance, when studying RNASE1 in howler monkeys, researchers assembled a comparative dataset of gene sequences across primates, translated and aligned the coding sequences, and tested for positive/purifying selection .

For MC1R analysis, researchers would:

  • Obtain MC1R sequences from Alouatta seniculus and other primates

  • Conduct multiple sequence alignments to identify conserved and variable regions

  • Calculate sequence identity percentages between species

  • Perform phylogenetic analysis to understand evolutionary relationships

  • Analyze selection pressures using methods such as dN/dS ratio calculations

What are the typical expression patterns of MC1R in Alouatta seniculus tissues?

To determine expression patterns, researchers would typically:

  • Collect tissue samples from various organs of Alouatta seniculus specimens

  • Extract RNA and perform quantitative RT-PCR to measure MC1R mRNA levels

  • Use immunohistochemistry with anti-MC1R antibodies to localize the protein in tissue sections

  • Compare expression levels across different tissues and potentially across different developmental stages

What structural adaptations does Alouatta seniculus MC1R exhibit compared to human MC1R?

  • Homology modeling of the Alouatta seniculus MC1R based on crystallographic data from other GPCRs

  • Molecular dynamics simulations to identify structural differences that might affect ligand binding or receptor activation

  • Site-directed mutagenesis to confirm the functional importance of unique residues

In humans, MC1R is known to be a highly polymorphic gene, with loss of function correlating with fair, UV-sensitive phenotypes and increased melanoma risk due to defective epidermal melanization and sub-optimal DNA repair . Comparative analysis of Alouatta seniculus MC1R might reveal adaptations related to its arboreal lifestyle and high UV exposure in the forest canopy.

How do evolutionary selection pressures on MC1R differ between canopy-dwelling Alouatta seniculus and other primates?

Although specific information about selection pressures on MC1R in Alouatta seniculus is not provided in the search results, we can infer potential differences based on their habitat and lifestyle.

Red howler monkeys spend almost their entire lives in the top canopy of forests , where UV exposure is higher than for ground-dwelling primates. This environmental factor likely creates different selection pressures on genes involved in UV protection, including MC1R.

A methodological approach to investigating evolutionary selection would include:

  • Sequence analysis of MC1R across multiple primate species, including canopy and ground-dwelling species

  • Calculation of dN/dS ratios to detect positive selection signatures

  • Branch-site models to identify lineage-specific selection

  • Correlation of MC1R sequence variations with ecological variables like habitat type, altitude, and UV exposure

What experimental protocols are optimal for expressing recombinant Alouatta seniculus MC1R in vitro?

For optimal expression of recombinant Alouatta seniculus MC1R in vitro, researchers should consider the following methodological approaches:

  • Expression system selection:

    • Mammalian cell lines (HEK293, CHO) for proper post-translational modifications

    • Insect cell systems (Sf9, High Five) for higher yields

    • E. coli systems for structural studies after optimization

  • Vector design considerations:

    • Codon optimization for the selected expression system

    • Addition of purification tags (His, FLAG, etc.)

    • Inclusion of signal peptides for proper membrane targeting

  • Expression protocol:

    • Transfection/transduction optimization (reagent selection, DNA:reagent ratio)

    • Induction conditions (time, temperature)

    • Harvest timing to maximize functional receptor yield

  • Functionality assessment:

    • Radioligand binding assays

    • cAMP accumulation assays

    • β-arrestin recruitment assays

How do functional responses of Alouatta seniculus MC1R compare to human MC1R when challenged with various agonists and antagonists?

A comprehensive functional comparison between Alouatta seniculus MC1R and human MC1R would employ the following methodological approach:

  • Preparation of cell lines expressing each receptor type at comparable levels

  • Dose-response curves for various ligands:

    • Natural agonists (α-MSH, ACTH)

    • Synthetic agonists (NDP-MSH, melanotan II)

    • Natural antagonists (agouti signaling protein, β-defensin 3)

    • Synthetic antagonists

  • Measurement of multiple signaling pathways:

    • cAMP production (primary pathway)

    • ERK1/2 phosphorylation

    • Calcium mobilization

    • β-arrestin recruitment

  • Data analysis:

    • Calculation of EC50/IC50 values

    • Efficacy measurements

    • Bias factor calculations for different signaling pathways

What techniques are most effective for isolating and cloning the Alouatta seniculus MC1R gene?

For effective isolation and cloning of the Alouatta seniculus MC1R gene, researchers should implement the following methodology:

  • Sample collection and DNA extraction:

    • Obtain tissue samples (skin, hair follicles) from Alouatta seniculus individuals

    • Extract high-quality genomic DNA using specialized kits for primate samples

    • Verify DNA quality via spectrophotometry and gel electrophoresis

  • PCR amplification strategies:

    • Design degenerate primers based on conserved regions of primate MC1R sequences

    • Alternatively, use specific primers based on related species (e.g., other Alouatta species)

    • Optimize PCR conditions (annealing temperature, Mg²⁺ concentration)

  • Cloning approach:

    • Selection of appropriate vectors (pGEM-T Easy for initial cloning, mammalian expression vectors for functional studies)

    • Transformation into competent cells

    • Colony screening methods (blue-white screening, colony PCR)

  • Sequencing verification:

    • Bi-directional Sanger sequencing

    • Analysis of chromatograms for sequence quality

    • Comparison with known MC1R sequences to confirm identity

Similar approaches have been used for amplifying microsatellites in Alouatta guariba, where researchers utilized PCR with species-specific primers and optimized conditions .

What gene duplication patterns exist for MC1R in Alouatta seniculus and how might they relate to the known RNASE1 duplication?

  • Comparative genomic analysis:

    • Genome sequencing or targeted capture sequencing of the MC1R locus

    • Analysis of read depth and haplotype assembly to detect potential duplications

    • BLAST searches against publicly available platyrrhine genomes

  • Evolutionary analysis:

    • Phylogenetic reconstruction to determine the timing of potential duplication events

    • Tests for selection (dN/dS analysis) to identify functional divergence

    • Ancestral sequence reconstruction

  • Functional divergence assessment:

    • Expression pattern analysis of potential duplicates

    • Biochemical characterization to identify specialized functions

The RNASE1 duplication in howler monkeys resulted in a conserved parent gene and a modified daughter gene (RNASE1B) with amino acid substitutions parallel to those found in colobines . If MC1R duplications exist in Alouatta seniculus, they might similarly show functional specialization related to the unique ecological niche of these primates.

How does the cAMP signaling pathway activated by Alouatta seniculus MC1R compare to the pathways in other primates?

The cAMP signaling pathway activated by MC1R is critical for its biological functions. A methodological approach to comparing Alouatta seniculus MC1R signaling with other primates would include:

  • Comparative signaling analysis:

    • Transfection of various primate MC1R constructs into the same cellular background

    • Measurement of cAMP accumulation following stimulation with standardized concentrations of α-MSH

    • Time-course experiments to assess activation and desensitization kinetics

  • Downstream effector analysis:

    • Western blotting for PKA activation and CREB phosphorylation

    • Gene expression analysis for melanogenesis-related genes (MITF, TYR, TYRP1)

    • Assessment of DNA repair enzyme upregulation (relevant to UV protection)

  • Pathway inhibition studies:

    • Use of specific inhibitors to identify potential differences in signaling dependencies

    • siRNA knockdown of pathway components to assess their relative importance across species

In humans, MC1R signaling leads to increased melanin synthesis and enhanced resistance to UV injury through improved antioxidant defenses and acceleration of nucleotide excision repair (NER) . The pathway also promotes phosphorylation of p53 at S15 in an ATR and DNA-PK dependent manner . Comparative analysis would reveal whether Alouatta seniculus shows similar or distinctive signaling patterns.

What role might Alouatta seniculus MC1R play in adaptation to their canopy-dwelling lifestyle?

Alouatta seniculus spend almost their entire lives near the top canopy of the forest , where UV exposure is significantly higher than at ground level. This environmental factor likely influences the evolution of their UV protection mechanisms, including MC1R function.

A methodological approach to investigating adaptive roles would include:

  • Ecological correlations:

    • Measurement of UV exposure in the forest canopy habitat

    • Skin and hair pigmentation analysis across different howler monkey populations

    • Correlation of MC1R variants with habitat characteristics

  • Comparative analysis with other canopy-dwelling species:

    • Sequence and functional comparison with MC1R from other arboreal primates

    • Investigation of convergent adaptations in distantly related canopy-dwelling mammals

  • UV resistance studies:

    • Ex vivo skin sample exposure to UV radiation

    • Measurement of DNA damage markers (thymine dimers, oxidative damage)

    • Assessment of DNA repair efficiency and correlation with MC1R function

  • Transgenic studies:

    • Creation of cell lines expressing Alouatta seniculus MC1R

    • Comparison of UV resistance with cells expressing MC1R from other species

What purification strategies yield the highest quality recombinant Alouatta seniculus MC1R protein?

Purifying membrane proteins like MC1R presents significant challenges. A methodological approach for optimal purification would include:

  • Detergent screening:

    • Test multiple detergents (DDM, LMNG, digitonin) for solubilization efficiency

    • Assess protein stability in each detergent using thermal shift assays

    • Optimize detergent concentration for maximum yield without denaturing the protein

  • Affinity chromatography approaches:

    • Utilize tandem affinity tags (His-MBP, His-SUMO) for improved purity

    • Optimize imidazole concentration in washing and elution buffers

    • Consider on-column folding strategies for improved functional recovery

  • Size exclusion chromatography:

    • Separate monomeric receptor from aggregates

    • Assess oligomeric state distribution

    • Buffer optimization during SEC to maintain protein stability

  • Quality control methods:

    • Circular dichroism to assess secondary structure

    • Functional binding assays to confirm activity

    • Mass spectrometry to confirm protein identity and modifications

What are the critical differences in experimental design when studying MC1R from Alouatta seniculus versus human MC1R?

When studying MC1R from Alouatta seniculus compared to human MC1R, researchers should consider these methodological differences:

  • Expression system adaptations:

    • Codon optimization specific to the source species

    • Temperature optimization based on the physiological temperature of howler monkeys

    • Consideration of species-specific post-translational modifications

  • Ligand selection considerations:

    • Use of both human and primate-specific melanocortin analogs

    • Testing species-specific antagonists (e.g., variations of agouti signaling protein)

    • Controls for species differences in ligand potency and affinity

  • Functional assay modifications:

    • Adjustment of assay conditions to match primate physiological parameters

    • Consideration of species-specific signaling partners

    • Development of appropriate positive and negative controls

  • Interpretation framework:

    • Accounting for differences in natural selective pressures

    • Consideration of the unique ecological niche of canopy-dwelling primates

    • Evolutionary context when interpreting functional differences

How do functional adaptations in Alouatta seniculus MC1R relate to their unique ecological niche?

Alouatta seniculus inhabits the upper canopy of forests and has the widest geographical distribution of all New World primates, ranging throughout the northern half of South America . This ecological context likely shapes MC1R function through specific adaptations.

A methodological approach to investigating these adaptations would include:

  • Ecological and behavioral correlation studies:

    • Assessment of UV exposure in different habitats within the Alouatta seniculus range

    • Correlation of MC1R variants with latitude, altitude, and forest density

    • Analysis of melanin content in hair and skin samples across populations

  • Comparative functional genomics:

    • Comparison of MC1R sequence and function across howler monkey species with different geographical distributions

    • Investigation of parallel adaptations in other canopy-dwelling mammals

    • Identification of unique amino acid substitutions under positive selection

  • Experimental functional analysis:

    • Site-directed mutagenesis to recreate ancestral MC1R states

    • Functional characterization of reconstructed ancestral proteins

    • Comparison with MC1R from terrestrial primates with similar geographical distributions

What can we learn about the evolution of pigmentation by studying Alouatta seniculus MC1R polymorphisms across populations?

The study of MC1R polymorphisms across Alouatta seniculus populations provides insights into pigmentation evolution. A methodological approach would include:

  • Population sampling strategy:

    • Collection of samples from multiple populations across the geographical range

    • Correlation of sampling locations with environmental variables (UV index, altitude, forest density)

    • Documentation of phenotypic variation in hair and skin pigmentation

  • Genetic analysis approach:

    • Targeted sequencing of the MC1R gene from multiple individuals per population

    • Haplotype analysis and assessment of population structure

    • Tests for selection signatures (Tajima's D, Fst outlier tests)

  • Structure-function correlation:

    • In vitro characterization of identified variants

    • Measurement of cAMP generation in response to melanocortin stimulation

    • Assessment of receptor expression and trafficking

  • Ecological correlation:

    • Statistical models correlating MC1R variation with environmental variables

    • Consideration of historical population movements and habitat changes

    • Integration with broader phylogeographic studies of howler monkeys

Similar approaches have been applied to study microsatellite markers in the brown howler (Alouatta guariba), which revealed important information about population structure relevant for conservation efforts .

What are the most promising research directions for understanding Alouatta seniculus MC1R function in ecological adaptation?

The study of Alouatta seniculus MC1R presents several promising research directions, particularly in understanding ecological adaptations. A methodological approach to these future studies would include:

  • Comprehensive population genetics:

    • Whole-genome sequencing across the geographical range

    • Environmental correlation studies linking MC1R variants to specific ecological variables

    • Historical demographic analysis to understand selection pressures over time

  • Functional genomics approaches:

    • CRISPR-based engineering of MC1R variants in model cell systems

    • Creation of "humanized" MC1R cell lines with Alouatta seniculus variants

    • High-throughput screening of responses to environmental stressors

  • Integrative ecological studies:

    • Field studies correlating MC1R variants with behavioral adaptations to UV exposure

    • Comparative analysis across multiple howler monkey species with different ecological niches

    • Assessment of climate change impacts on selection pressures

  • Conservation applications:

    • Use of MC1R as a marker for population health and genetic diversity

    • Development of non-invasive sampling techniques for MC1R genotyping

    • Integration of genetic data into conservation management plans

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.