Recombinant Alpha-1,3/1,6-mannosyltransferase ALG2 (ALG2)

Shipped with Ice Packs
In Stock

Description

General Information

Apoptosis-linked gene 2 (ALG2) is a calcium-binding protein with a molecular weight of approximately 22 kDa, encoded by the PDCD6 gene . It contains five potential EF-hand Ca2+-binding sites and has been shown to be directly related to apoptosis .

Protein Structure and Function

ALG2 is expressed as a single polypeptide chain . In a calcium-free environment, ALG2 forms a weak homodimer in solution. The fifth EF-hand Ca2+-binding motif likely participates in the formation of this dimer complex . ALG2 possesses two strong Ca2+-binding sites, and Ca2+ binding induces significant conformational changes in both the N-terminal and C-terminal domains of the protein . Calcium binding to both strong Ca2+-binding sites of ALG2 is required for ion-induced aggregation of the protein .

Recombinant Production and Purification

An efficient expression and purification scheme has been developed for recombinant ALG2, which allows for the routine production of purified recombinant protein with a yield of approximately 100 mg per liter of bacterial cell cultures .

Role in Glycosylation

ALG2 functions as an alpha-1,3/1,6-mannosyltransferase . It is involved in the biosynthesis of lipid-linked oligosaccharides (LLO), specifically controlling the accumulation of M2Gn2 (α-1,6) intermediate . In vitro assays using immunoprecipitated ALG2 from yeast and human embryonic kidney cells (HEK293) have demonstrated both MTase activities . Recombinant yeast ALG2 (ScAlg2) directly transfers an α1,3-Man, followed by an α1,6-Man onto a M1Gn2 to generate M3Gn2 . Human ALG2 (hAlg2) has a higher specific MTase activity and, unlike ScAlg2, is independent of added membrane in vitro .

Topological and Enzymatic Analysis

Human Alg2 protein attaches to the ER membrane with a single membrane-binding domain. Experiments were designed to map the orientation of the hAlg2 N-terminus, using hAlg2 fused to a fragment of yeast invertase (Suc2A) .

Mannosyltransferase Activity of AnpA

AnpA exhibits in vitro α-(1→6)-mannosyltransferase activity. Recombinant AnpA was prepared using a bacterial expression system, and mannosyltransferase activity was measured at 30°C for 16 h using purified recombinant AnpA (0.1 μg/μL), α-Man-pNP (1.5 mM) as a sugar acceptor, GDP-Man (5 mM) as a sugar donor, and Mn2+ (1.0 mM) as a cofactor . The product of AnpA was identified as α-Man-(1→6)-α-Man-pNP, confirming its α-(1→6)-mannosyltransferase activity in vitro .

Involvement in Cellular Processes

ALG-2 acts as a Ca2+-sensitive adaptor to concentrate and polymerize TFG at ERES, supporting a potential role for ALG-2 in COPII-dependent trafficking from the endoplasmic reticulum . ALG2, along with COPII and ESCRTs, mediates lysosome-dependent ERES microautophagy induced by nutrient stress .

Clinical Significance

Mutations in ALG2, along with ALG14, have been identified as causing a congenital myasthenic syndrome .

Mnn9p-Containing Complexes

Mnn9p-containing complexes in the cis Golgi have mannosyltransferase activity and are capable of making polymeric structures containing both α-1,6- and α-1,2-linked mannoses .
Treatment with α1-6 exomannosidase reduced the intensity of the ladder releasing 63% of the labeled mannose as monomer . Treatment with the α1-2,3 exomannosidase released only 7% as monomer, but digestion with both enzymes resulted in the complete conversion of the labeled ladder into monomer .

Table 1: In vitro activity of ScAlg2 and hAlg2

ProteinSubstrate Conversion to M2Gn2 (%)Substrate Conversion to M3Gn2 (%)
ScAlg24224
hAlg21486

Table 2: Distances between α-Man-OMe and GDP-Man

Atom PairAverage Distance (Å)
6-OH oxygen and mannose site 1-C of GDP-Man3.72 ± 0.66

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ALG2; Alpha-1,3/1,6-mannosyltransferase ALG2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Dol alpha-1,6-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-455
Protein Length
full length protein
Species
Rhizomucor pusillus
Target Names
ALG2
Target Protein Sequence
MTSKSLNVAFIHPDLGIGGAERLVVDAAVGIQKKGHQVIFYTSHHDPNHCFEETRDGTLK VQVRGDWLPRTIFGRFYILCAILRQFVLVASLILWERHSYDIFFVDQLSACVPLLKWFTT AKILFYCHFPDKLLTQRNSTIKKLYRAPVDKMEELTTGMSDLIAVNSGFTAGMFKKSFPS VHQTPQILYPPINFDAYDRPVDRNDPTVKILETDKRVLLSINRFERKKNVELALRAFAAL KIKNMVPKDVFANYRLVLAGGYDKRVRENVEYLEELDQLATEEFGLQTFTIHPSSAAADV PADAQVVFLCSFNDAQRTFLLDQAKLLLYTPSNEHFGITPVEGMYASVPVIAVNTGGPVE TVKNKETGLLLPSDPDVWAEGIRDFIIEKYNGKQMGQHGRQHVQSKFSLPAFADRLEAMM IELETSTPDQSSSGAVYLLGAIGVLFACIIYCIKQ
Uniprot No.

Target Background

Function
Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ALG2 and what are its primary functions?

ALG2 is a glycosyltransferase that plays a crucial role in the early steps of N-glycosylation, an essential post-translational modification process. It possesses dual mannosyltransferase activities, catalyzing the addition of mannose residues in both α1,3 and α1,6 linkages to the lipid-linked oligosaccharide precursor. Specifically, ALG2 transfers mannose from GDP-mannose donors to the Man₁GlcNAc₂-PP-dolichol (M₁Gn₂-PDol) acceptor substrate to form the branched Man₃GlcNAc₂-PP-dolichol (M₃Gn₂-PDol) product .

The enzyme is essential for proper protein glycosylation in the endoplasmic reticulum (ER), and defects in ALG2 have been associated with congenital disorders of glycosylation (CDG), highlighting its biological significance in cellular function and human health.

How does the structure of human ALG2 (hALG2) differ from yeast ALG2 (ScALG2)?

Despite the conservation of the N-glycosylation pathway across eukaryotes, human and yeast ALG2 structures have significantly diverged with distinct ER-binding topologies:

FeatureHuman ALG2 (hALG2)Yeast ALG2 (ScALG2)
ER membrane associationSingle membrane-binding domainFour hydrophobic domains
Protein stabilityHigher stability in vitroLower stability, requires addition of crude membranes or neutral bilayer lipids
N-terminus orientationNot specified in search resultsNot specified in search results
C-terminus orientationCytosolicNot specified in search results

The structural divergence between human and yeast ALG2 has important implications for experimental design when studying this enzyme. The enhanced stability of human ALG2 makes it more amenable to in vitro biochemical and structural studies compared to its yeast counterpart .

What are the optimal conditions for expressing and purifying recombinant hALG2?

For optimal expression and purification of recombinant human ALG2:

  • Expression System: Use a eukaryotic expression system such as HEK293 cells to ensure proper folding and post-translational modifications.

  • Fusion Tags: Include affinity tags such as FLAG for immunoprecipitation and purification. The search results mention successful use of FLAG-tagged constructs for functional hALG2 .

  • Purification Strategy:

    • Utilize the enhanced stability of hALG2 compared to ScALG2

    • Maintain native membrane interaction through the single membrane-binding domain

    • Employ detergent solubilization followed by affinity chromatography

  • Activity Preservation: Unlike ScALG2, which requires addition of crude membranes or neutral bilayer lipids for optimal activity, purified hALG2 maintains activity under more standard buffer conditions due to its higher inherent stability .

When designing fusion constructs, researchers should consider that both N-terminally and C-terminally tagged hALG2 constructs (FLAG-Suc2A-hAlg2 and hAlg2-Suc2A-FLAG) have been shown to retain enzymatic activity and can complement yeast alg2 mutants .

How can researchers effectively assay ALG2 enzymatic activity in vitro?

To effectively assay ALG2 enzymatic activity:

  • Substrate Preparation:

    • Acceptor substrate: Man₁GlcNAc₂-PP-dolichol (M₁Gn₂-PDol) or its soluble analog Man₁GlcNAc₂-PP-phytanyl (M₁Gn₂-PPhy)

    • Donor substrate: GDP-mannose

  • Reaction Conditions:

    • Monitor reaction kinetics under physiological conditions (pH ~7.4, 37°C for human ALG2)

    • Test variable concentrations of GDP-mannose and M₁Gn₂ substrate to observe changes in reaction preference

  • Analysis Methods:

    • Employ liquid chromatography-mass spectrometry (LC-MS) for quantitative kinetics assay

    • This approach allows for precise measurement of reaction intermediates and products, specifically distinguishing between M₂Gn₂(α-1,3) and M₂Gn₂(α-1,6) intermediates

  • Controls and Comparisons:

    • Include parallel assays with ScALG2 for comparative analysis

    • Normalize activity based on protein concentration and purity

The development of a quantitative LC-MS kinetics assay for purified hALG2 has been particularly valuable for studying the enzyme's preferential order of mannose addition and how this preference is modulated by substrate concentrations .

How does the reaction order preference of hALG2 change under different substrate conditions?

Human ALG2 exhibits a complex relationship between substrate conditions and reaction order preference:

ConditionPreferred Reaction OrderProduct Distribution
Physiological conditionsTransfer of α1,3-Man before α1,6-ManPredominant formation of M₂Gn₂(α-1,3) intermediate
Excess GDP-mannose donorShift toward early α1,6-Man transferIncreased formation of M₂Gn₂(α-1,6) intermediate
Increased M₁Gn₂ substrateShift toward early α1,6-Man transferIncreased formation of M₂Gn₂(α-1,6) intermediate

This substrate-dependent reaction preference suggests a potential regulatory mechanism where ALG2 can control the accumulation of the M₂Gn₂(α-1,6) intermediate in response to changes in cellular conditions .

The ability to modulate reaction order based on substrate availability may represent an evolutionary adaptation to fine-tune the N-glycosylation pathway in response to metabolic fluctuations. Researchers investigating ALG2 should carefully consider and control substrate concentrations in their experimental designs to account for these preference shifts.

What approaches can be used to investigate the topological differences between yeast and human ALG2?

To investigate the topological differences between yeast and human ALG2:

  • Fusion Protein Approaches:

    • Generate fusion constructs with reporter proteins like Suc2A (invertase) and epitope tags (e.g., FLAG)

    • Position fusions at both N- and C-termini to determine membrane orientation

    • Verify activity of fusion proteins by complementation assays in relevant mutant strains

  • Glycosylation Status Analysis:

    • Assess N-glycosylation status of appropriately positioned reporter domains

    • This approach can determine whether specific regions face the ER lumen (glycosylated) or cytosol (non-glycosylated)

  • Protease Protection Assays:

    • Perform selective membrane permeabilization followed by protease digestion

    • Analyze which domains are protected or accessible in intact vs. permeabilized membranes

  • Comparative Structural Prediction:

    • Use computational approaches to predict membrane-spanning regions

    • Compare predicted topologies between species

The topological analysis of hALG2 has revealed that it associates with the ER via a single membrane-binding domain, in contrast to ScALG2 which interacts through four hydrophobic domains. Successful implementations of this approach include the use of Suc2A-fusion proteins with hALG2 and hALG1 as a control .

How might ALG2 regulate the LLO biosynthetic pathway?

ALG2 may serve as a key regulatory point in the lipid-linked oligosaccharide (LLO) biosynthetic pathway through several mechanisms:

  • Control of Reaction Intermediates:

    • By modulating the order of mannose addition (α1,3 vs. α1,6) in response to substrate conditions

    • This leads to controlled accumulation of M₂Gn₂(α-1,6) intermediate under specific cellular conditions

  • Response to Metabolic Status:

    • Sensitivity to GDP-mannose levels links N-glycosylation progress to cellular metabolic state

    • Increased donor substrate (GDP-mannose) triggers production of the M₂Gn₂(α-1,6) intermediate

  • Checkpoint Function:

    • The bifunctional nature of ALG2 allows it to potentially serve as a checkpoint in the pathway

    • Regulation at this early step could prevent unnecessary resource expenditure under suboptimal conditions

Research suggests that ALG2 may regulate the LLO biosynthetic pathway by controlling accumulation of the M₂Gn₂(α-1,6) intermediate, providing a mechanism to adjust pathway flux according to cellular needs .

What experimental design would best test the hypothesis that ALG2 acts as a metabolic sensor in the N-glycosylation pathway?

To test the hypothesis that ALG2 functions as a metabolic sensor in the N-glycosylation pathway:

  • Cellular Metabolic Manipulation:

    • Design experiments that systematically alter cellular GDP-mannose levels through:

      • Mannose supplementation or restriction

      • Inhibition or overexpression of GDP-mannose synthesizing enzymes

      • Creation of conditional mutants affecting mannose metabolism

  • Quantitative Analysis of Glycan Intermediates:

    • Employ LC-MS to quantify M₁Gn₂, M₂Gn₂(α-1,3), M₂Gn₂(α-1,6), and M₃Gn₂ species

    • Track changes in intermediate ratios under different metabolic conditions

  • In Vitro Reconstitution with Varying Substrates:

    • Create a matrix of conditions varying both GDP-mannose and M₁Gn₂ concentrations

    • Measure reaction rates and product distributions across these conditions

  • Site-Directed Mutagenesis:

    • Identify and mutate potential GDP-mannose sensing residues

    • Test mutants for altered responses to varying GDP-mannose levels

  • Computational Modeling:

    • Develop kinetic models that integrate experimental data

    • Use models to predict pathway behavior under various metabolic scenarios

This experimental approach would generate data to determine whether ALG2 activity responds to GDP-mannose availability in a manner consistent with a metabolic sensing function, potentially explaining the observed shift in reaction preference under varying substrate conditions .

What insights can be gained from comparing the biochemical properties of human and yeast ALG2?

Comparing the biochemical properties of human and yeast ALG2 provides valuable insights into enzyme evolution and adaptation:

PropertyHuman ALG2 (hALG2)Yeast ALG2 (ScALG2)Research Implications
Membrane topologySingle membrane-binding domainFour hydrophobic domainsSuggests different evolutionary solutions to ER association
In vitro stabilityHigher stabilityRequires lipid addition for stabilityhALG2 is more amenable to biochemical characterization
Enzymatic activityBifunctional (α1,3 and α1,6 MTase)Bifunctional (α1,3 and α1,6 MTase)Core function conserved despite structural divergence
Reaction preferenceα1,3-Man before α1,6-Man under physiological conditionsCan add mannose residues in either orderPossible species-specific regulatory mechanisms

This comparative approach highlights how core enzymatic functions can be preserved while peripheral properties like membrane interaction evolve independently, providing a window into both the conservation and divergence of essential cellular pathways across eukaryotic evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.