Recombinant Alteromonas macleodii UPF0761 membrane protein MADE_1017605/MADE_1018330 (MADE_1017605)

What is Alteromonas macleodii UPF0761 membrane protein MADE_1017605/MADE_1018330?

Alteromonas macleodii UPF0761 membrane protein MADE_1017605/MADE_1018330 (MADE_1017605) is a full-length membrane protein (294 amino acids) derived from the marine bacterium Alteromonas mediterranea . This protein belongs to the UPF0761 family of membrane proteins with currently undetermined function. The protein has a UniProt ID of B4RYA6 and contains multiple hydrophobic regions that anchor it within the cell membrane . The complete amino acid sequence is: MDLDKVKTFYNNVAPQLRDLFGIFIKRCKEDNITISAGHLAYVTLLSLVPFIMVTFTIMSAFPAFASVRSKLEHFVFSNFVPTASDVVHKYMTDFVGNASQMSAIGILSLLVVALMLISN VDKTLNRIWRTQSDRPIVYTFAIYWMVITLGPMLIGSSVVVSSYLTGLAAFTEEYTPGLGTFLLSLVPSGAALLAFAILYMVVPNRRVYARHAFVGAIVATIAFEITKSGFALYVTNFPSYELIYGALAVVPILFLWVYLSWIIVLFGAEFTCSLGEAFENKKAEHAPRKVPKE .

Why are researchers interested in studying this specific membrane protein?

Researchers are interested in this protein for several scientific reasons. First, membrane proteins constitute approximately 30% of the human genome and play critical roles in cellular function, particularly in cell communication and transport pathways . Despite their importance, membrane proteins remain understudied due to their hydrophobic nature and difficulties in structural characterization, with only about 50 out of 8,000 known human membrane proteins having determined structures . The study of bacterial membrane proteins like UPF0761 from A. macleodii provides model systems for understanding fundamental mechanisms of membrane protein function that may have parallels in more complex organisms. Additionally, A. macleodii is a cosmopolitan marine bacterium that produces membrane vesicles containing proteins involved in iron and phosphate uptake as well as biofilm formation , making its membrane proteins particularly relevant for understanding bacterial adaptation to marine environments.

What are the structural characteristics of the UPF0761 membrane protein?

The UPF0761 membrane protein from A. macleodii is a full-length protein consisting of 294 amino acids . While detailed three-dimensional structural information is not yet available in the current literature, analysis of its amino acid sequence reveals several key structural features:

• Multiple hydrophobic regions typical of transmembrane segments

• N-terminal His tag in the recombinant version

• Predicted membrane-spanning domains based on hydrophobicity profiles

The challenge in determining the complete structure lies in the general difficulties associated with membrane protein studies. Their hydrophobic nature prevents them from dissolving in water and crystallizing – a necessary step in techniques such as X-ray crystallography . The protein likely features the characteristic alpha-helical transmembrane domains commonly found in bacterial membrane proteins, with hydrophobic amino acid residues facing the lipid bilayer and hydrophilic residues facing either the cytoplasm or extracellular space.

How does the genomic context of MADE_1017605/MADE_1018330 vary among Alteromonas strains?

The genomic context of the MADE_1017605/MADE_1018330 gene varies significantly among different Alteromonas macleodii strains. Genomic analysis of various A. macleodii isolates has revealed considerable diversity, with strains belonging to different clonal frames (CFs) that differ by approximately 30,000 single-nucleotide polymorphisms (SNPs) across their core genomes . These variations are particularly evident in flexible genomic islands, which can be classified into two types:

• Additive genomic islands: Contain different numbers of gene cassettes and show high variability even within a single clonal frame

• Replacement genomic islands: More stable but involve complete replacement of genomic fragments with different genes

Evidence exists for frequent recombination events between or within clonal frames, and even with the distantly related A. macleodii surface ecotype . These recombination events potentially affect the genetic context of membrane proteins like UPF0761, potentially leading to variations in expression patterns, regulation, or even protein function across different strains.

What challenges are associated with the recombinant expression of the UPF0761 membrane protein?

The recombinant expression of UPF0761 membrane protein faces several significant challenges that are common to membrane proteins:

These challenges collectively contribute to the low expression yields of membrane proteins, which adversely affects structural and functional studies .

How do the membrane vesicles from Alteromonas macleodii relate to the UPF0761 membrane protein function?

Membrane vesicles (MVs) produced by Alteromonas macleodii represent an important aspect of its biology that may relate to UPF0761 membrane protein function. A. macleodii strains vary in their MV production rates, with some releasing up to 30 MVs per cell per generation . These MVs display heterogeneous morphologies, including some that aggregate within larger membrane structures .

Proteomic characterization has revealed that A. macleodii MVs are rich in membrane proteins related to:

• Iron uptake systems

• Phosphate transport mechanisms

• Proteins with potential functions in biofilm formation

Additionally, these MVs harbor ectoenzymes such as aminopeptidases and alkaline phosphatases, which can comprise up to 20% of the total extracellular enzymatic activity . While specific information about the presence of UPF0761 in these vesicles is not directly mentioned in the available literature, the protein's membrane localization makes it a potential candidate for inclusion in MVs.

The functional significance of this relationship would be valuable to explore, as MVs may serve as delivery vehicles for membrane proteins, potentially supporting bacterial growth through generation of extracellular "hotspots" that facilitate access to essential substrates . Understanding whether UPF0761 is present in MVs and its potential role in these structures could provide insights into its physiological function.

What approaches can be used to determine the three-dimensional structure of the UPF0761 membrane protein?

Determining the three-dimensional structure of membrane proteins like UPF0761 requires specialized approaches due to their hydrophobic nature. Several complementary techniques can be employed:

• X-ray crystallography with optimized conditions:

  • Use of specialized detergents or lipidic cubic phase methods

  • Incorporation of fusion partners or antibody fragments to increase solubility and crystallization propensity

  • Stabilizing mutations to enhance thermal stability

• Cryo-electron microscopy (Cryo-EM):

  • Particularly valuable for membrane proteins as it doesn't require crystallization

  • Sample preparation in detergent micelles, nanodiscs, or amphipols

  • Can resolve structures to near-atomic resolution for larger membrane proteins

• Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Solution NMR for smaller membrane proteins or domains

  • Solid-state NMR for proteins in a more native-like membrane environment

  • Requires isotopic labeling (15N, 13C) of the recombinant protein

• Computational modeling approaches:

  • Homology modeling based on related proteins with known structures

  • Ab initio modeling using advanced algorithms

  • Molecular dynamics simulations to understand dynamic behaviors

• Hybrid approaches:

  • Combining low-resolution structural data from techniques like small-angle X-ray scattering (SAXS) with computational modeling

  • Integrating crosslinking mass spectrometry data to establish distance constraints

Each of these approaches has strengths and limitations, and often a combination of methods is necessary to obtain a complete structural understanding of membrane proteins like UPF0761.

What evolutionary insights can be gained from comparing UPF0761 across different Alteromonas strains and related bacteria?

Evolutionary analysis of UPF0761 across different Alteromonas strains and related bacteria can provide valuable insights into bacterial adaptation and protein function evolution. The genomic diversity of Alteromonas macleodii is substantial, with strains belonging to different clonal frames that differ by approximately 30,000 SNPs across their core genomes . Specific evolutionary insights include:

• Conservation patterns: Highly conserved regions likely represent functionally critical domains, while variable regions may indicate adaptation to specific environmental conditions.

• Horizontal gene transfer: Evidence for frequent recombination events between or within clonal frames, and even with distantly related A. macleodii surface ecotype , suggests that membrane protein genes like UPF0761 might be subject to horizontal gene transfer, potentially leading to functional diversification.

• Selective pressures: Analysis of synonymous versus non-synonymous substitutions can reveal whether the protein is under positive, neutral, or purifying selection in different bacterial lineages.

• Genomic context conservation: The flexible genomic islands identified in A. macleodii may affect the genomic context of UPF0761, potentially influencing its expression patterns or functional associations.

• Structural evolution: Comparing the predicted structural features across homologs can reveal evolutionary constraints on membrane protein architecture and identify regions critical for maintaining structural integrity versus those allowing functional diversification.

This evolutionary perspective can provide crucial context for understanding the current function of UPF0761 and may suggest experimental approaches to elucidate its role in bacterial physiology.

What expression systems are optimal for producing recombinant UPF0761 membrane protein?

Several expression systems can be considered for optimal production of recombinant UPF0761 membrane protein, each with distinct advantages:

For UPF0761 specifically, E. coli has been successfully used with an N-terminal His tag . Optimizations for E. coli expression include:

• Selection of appropriate strain (e.g., C41(DE3), C43(DE3) for membrane proteins)

• Use of weak promoters to prevent overexpression toxicity

• Lower induction temperatures (16-25°C) to slow expression and improve folding

• Supplementation with specific lipids to mimic native membrane environment

• Codon optimization for the host organism

The choice of expression system should be guided by the specific research goals, required protein yield, and downstream applications.

What purification strategies are most effective for isolating UPF0761 membrane protein?

Purification of membrane proteins like UPF0761 requires specialized strategies to maintain protein stability and functionality. The following approach is recommended based on the recombinant His-tagged UPF0761:

Step 1: Membrane isolation and solubilization

• Harvest E. coli cells expressing UPF0761 by centrifugation

• Disrupt cells using sonication, French press, or enzymatic lysis

• Isolate membrane fraction through differential centrifugation

• Solubilize membranes using appropriate detergents:

  • Initial screening of multiple detergents (DDM, LDAO, DMNG)

  • Optimize detergent concentration to balance extraction efficiency and protein stability

Step 2: Affinity chromatography

• Utilize the N-terminal His tag for IMAC (Immobilized Metal Affinity Chromatography)

• Equilibrate column with solubilization buffer containing detergent

• Load solubilized membrane fraction

• Wash with increasing imidazole concentrations to reduce non-specific binding

• Elute with high imidazole concentration buffer

Step 3: Size exclusion chromatography

• Further purify protein by size exclusion chromatography

• Assess protein homogeneity and oligomeric state

• Collect fractions containing monomeric or specific oligomeric forms

Step 4: Detergent exchange (if needed)

• Exchange harsh solubilization detergent with milder detergent for functional studies

• Consider amphipols or nanodiscs for enhanced stability

Step 5: Quality control

• Verify purity by SDS-PAGE (>90% purity expected)

• Confirm identity by Western blot or mass spectrometry

• Assess protein functionality through activity assays

Storage considerations:

• Store at -20°C/-80°C with 6% trehalose in Tris/PBS-based buffer (pH 8.0)

• Avoid repeated freeze-thaw cycles

• For long-term storage, addition of 5-50% glycerol is recommended

This purification strategy must be optimized specifically for UPF0761, as different membrane proteins may require adjustments to detergent types, buffer compositions, and chromatography conditions.

How can researchers assess the functional activity of purified UPF0761 membrane protein?

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure content

  • Thermal shift assays to determine protein stability

  • Limited proteolysis to assess folding state

  • Fluorescence spectroscopy to probe tertiary structure

• Lipid interaction studies:

  • Liposome binding assays to evaluate membrane association

  • Fluorescence anisotropy measurements with labeled lipids

  • Monolayer penetration experiments

• Transport activity testing (if UPF0761 functions as a transporter):

  • Reconstitution into liposomes or nanodiscs

  • Measurement of substrate transport across membranes using fluorescent reporters

  • Electrophysiological measurements (patch-clamp) if ion transport is suspected

• Binding partner identification:

  • Pull-down assays with potential interacting proteins

  • Crosslinking mass spectrometry to identify proximity partners

  • Surface plasmon resonance (SPR) to measure binding affinities

  • Yeast two-hybrid or bacterial two-hybrid screening

• Functional complementation:

  • Expression in knockout strains to rescue phenotypes

  • Heterologous expression in systems lacking similar proteins

• Comparative analysis with homologous proteins:

  • Alignment with functionally characterized homologs

  • Structure-guided functional prediction

Since UPF0761 is found in Alteromonas macleodii, which produces membrane vesicles containing proteins involved in iron and phosphate uptake , functional assays related to these processes may be particularly relevant. For instance, testing the protein's ability to bind iron compounds or phosphate, or its potential role in membrane vesicle formation could provide valuable insights into its physiological role.

What are the best methods for studying UPF0761 protein-lipid interactions?

Understanding protein-lipid interactions is crucial for membrane proteins like UPF0761, as these interactions can significantly influence structure, stability, and function. Several complementary methods can be employed:

• Reconstitution systems:

  • Liposomes: Incorporate purified UPF0761 into artificial lipid vesicles with defined compositions

  • Nanodiscs: Small disc-shaped lipid bilayers stabilized by scaffold proteins

  • Lipid cubic phases: Three-dimensional lipid networks that mimic membrane environments

• Biophysical techniques:

  • Differential scanning calorimetry (DSC): Measures thermal transitions in protein-lipid mixtures

  • Isothermal titration calorimetry (ITC): Quantifies binding thermodynamics

  • Surface plasmon resonance (SPR): Measures real-time binding kinetics

• Spectroscopic methods:

  • Förster resonance energy transfer (FRET): Uses fluorescently labeled lipids and proteins to detect proximity

  • Attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR): Provides information about protein secondary structure in membrane environments

  • Solid-state NMR: Detects specific protein-lipid interactions in native-like environments

• Microscopy approaches:

  • Cryo-electron microscopy: Visualizes protein-lipid complexes at near-atomic resolution

  • Atomic force microscopy (AFM): Provides topographical information and can measure interaction forces

• Computational methods:

  • Molecular dynamics simulations: Models protein behavior in lipid bilayers

  • Coarse-grained simulations: Allows simulation of longer timescales relevant for lipid interactions

• Chemical biology approaches:

  • Photoactivatable lipid analogs: Create covalent crosslinks upon UV exposure

  • Click chemistry with lipid analogs: Allows detection of specific interactions

For UPF0761 specifically, initial characterization could involve reconstitution into liposomes with lipid compositions mimicking the Alteromonas macleodii membrane environment, followed by stability and functional assays. Changes in protein behavior with different lipid compositions could provide insights into specific lipid requirements or preferences.

What are the main obstacles in determining the physiological function of UPF0761 membrane protein?

Determining the physiological function of UPF0761 membrane protein faces several significant obstacles:

• Limited functional annotation: As a UPF (Uncharacterized Protein Family) member, there is minimal pre-existing functional information, creating a "starting from scratch" scenario for functional characterization .

• Structural challenges: The hydrophobic nature of membrane proteins makes structural determination difficult, limiting structure-based functional predictions. Of approximately 8,000 known membrane proteins, only about 50 have determined structures .

• Technical limitations in native environment studies: Studying the protein in its native membrane environment is challenging due to the complexity of bacterial membranes and difficulties in specific protein tagging without functional disruption.

• Redundancy and compensatory mechanisms: Potential functional redundancy with other membrane proteins may mask phenotypes in knockout studies, complicating functional assignment.

• Context-dependent functionality: The protein may only exhibit its function under specific environmental conditions relevant to Alteromonas macleodii's marine habitat, which are difficult to replicate in laboratory settings.

• Limited comparative genomics insights: As an uncharacterized protein family, there may be few well-characterized homologs to provide functional clues through sequence comparison.

• Challenges in reconstituting membrane protein systems: Recreating the proper membrane environment, interaction partners, and physiological conditions for functional assays is technically demanding.

• Post-translational modifications: Potential modifications that might be essential for function may be missed in recombinant expression systems .

Overcoming these obstacles requires integrated approaches combining structural biology, functional genomics, biochemical characterization, and ecological studies specific to Alteromonas macleodii's natural habitat.

How can cryo-electron microscopy be optimized for structural studies of UPF0761?

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, but optimizing it for UPF0761 requires addressing several challenges:

• Sample preparation optimization:

  • Detergent screening: Identify detergents that maintain protein stability while minimizing background in images

  • Alternative systems: Evaluate nanodiscs, amphipols, or SMALPs (Styrene Maleic Acid Lipid Particles) to better mimic native environment

  • Protein engineering: Consider fusion partners or binding proteins to increase particle size and asymmetry

• Vitrification parameters:

  • Blotting conditions: Optimize blotting time and force to achieve ideal ice thickness

  • Grid types: Test different grid types and surface treatments to improve particle distribution

  • Additives: Evaluate use of surfactants or other additives to prevent protein aggregation at air-water interface

• Data collection strategies:

  • Dose fractionation: Implement optimal electron dose strategies to balance signal-to-noise ratio with radiation damage

  • Motion correction: Apply frame alignment algorithms to correct for beam-induced motion

  • Defocus series: Collect data at various defocus values to enhance contrast while preserving high-resolution information

• Image processing approaches:

  • 2D classification: Optimize classification parameters to separate different conformational states

  • 3D classification: Implement strategies to identify and resolve conformational heterogeneity

  • Focused refinement: Apply local refinement techniques to enhance resolution of key domains

• Validation strategies:

  • Independent half-map refinement: Ensures against overfitting

  • Model validation: Use complementary biophysical techniques to validate the cryo-EM structure

  • Functional correlation: Connect structural features to functional data

• Specific considerations for UPF0761:

  • With 294 amino acids , UPF0761 is relatively small for cryo-EM, potentially requiring strategies to increase molecular weight

  • Consider antibody fragment complexes or engineered protein chimeras to increase size and add asymmetric features

By systematically addressing these aspects, cryo-EM can be optimized for determining the structure of UPF0761, potentially revealing insights into its function in Alteromonas macleodii.

What insights might be gained from studying UPF0761 in the context of Alteromonas macleodii membrane vesicles?

Studying UPF0761 in the context of Alteromonas macleodii membrane vesicles (MVs) could provide unique insights into both the protein's function and bacterial adaptation mechanisms:

• Functional context insights:

  • Determine whether UPF0761 is selectively packaged into MVs or excluded from them

  • Assess if UPF0761 plays a structural role in MV formation or stability

  • Investigate potential co-localization with other proteins involved in iron and phosphate uptake already identified in A. macleodii MVs

• Environmental adaptation mechanisms:

  • Explore UPF0761's potential role in creating extracellular "hotspots" through MVs

  • Investigate whether environmental conditions (nutrient availability, temperature, salinity) affect UPF0761 incorporation into MVs

  • Assess if UPF0761 contributes to the enzymatic activity associated with MVs, which can comprise up to 20% of total extracellular enzymatic activity

• Intercellular communication:

  • Determine if UPF0761-containing MVs facilitate interactions between A. macleodii cells or with other marine microorganisms

  • Investigate potential signaling functions within microbial communities

• Evolutionary perspectives:

  • Compare UPF0761 presence in MVs across different A. macleodii strains that belong to different clonal frames

  • Assess if recombination events affecting UPF0761 influence its incorporation into MVs

• Biotechnological applications:

  • Evaluate the potential of UPF0761-containing MVs as delivery vehicles for enzymes or other cargo

  • Investigate if UPF0761 could be used to enhance MV production or targeting

• Structural biology opportunities:

  • Study UPF0761 structure in the native membrane environment of MVs

  • Compare with structures determined in artificial systems to assess native conformations

Since A. macleodii strains can produce up to 30 MVs per cell per generation , there is abundant material for studying UPF0761 in this context, potentially overcoming some of the challenges associated with direct membrane protein investigation.

How might genomic and transcriptomic approaches contribute to understanding UPF0761 function?

Genomic and transcriptomic approaches offer powerful avenues for elucidating UPF0761 function without requiring protein purification, providing complementary insights to biochemical studies:

• Comparative genomics strategies:

  • Gene neighborhood analysis: Identify consistently co-localized genes across different Alteromonas strains that might functionally relate to UPF0761

  • Phylogenetic profiling: Compare presence/absence patterns of UPF0761 across bacteria to identify correlated genes with shared functions

  • Analysis of genomic islands: Determine if UPF0761 is located within flexible genomic islands or the core genome of A. macleodii

  • Detection of horizontal gene transfer: Identify potential acquisition events that might suggest functional adaptation

• Transcriptomic approaches:

  • RNA-Seq under varying conditions: Identify conditions that induce or repress UPF0761 expression (e.g., nutrient limitation, temperature changes, salinity)

  • Co-expression network analysis: Identify genes with correlated expression patterns that may function in the same pathway

  • Transcriptional response to stressors: Determine if UPF0761 is part of specific stress responses in A. macleodii

  • Differential expression across growth phases: Assess temporal expression patterns during bacterial growth

• Functional genomics techniques:

  • Gene knockout/knockdown: Create UPF0761 deletion mutants and assess phenotypic changes

  • CRISPR interference (CRISPRi): Repress UPF0761 expression and analyze consequences

  • Transposon mutagenesis screens: Identify genes with synthetic lethal or suppressor relationships with UPF0761

  • Reporter gene fusions: Monitor expression patterns in situ

• Integrated multi-omics approaches:

  • Combine genomic, transcriptomic, and proteomic data to build comprehensive models of UPF0761 function

  • Correlate UPF0761 expression with metabolomic profiles to identify potential metabolic roles

These approaches would be particularly valuable given the genomic diversity observed in A. macleodii strains, which belong to different clonal frames differing by approximately 30,000 SNPs . Understanding how UPF0761 expression and genetic context vary across these strains could provide crucial insights into its physiological role and evolutionary significance.