Recombinant Amblysomus hottentotus Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Functional and Pharmacological Insights

ADRA2B belongs to the alpha-2 adrenergic receptor family, which regulates vasoconstriction, neurotransmitter release, and blood pressure . While the Amblysomus protein shares structural homology with human ADRA2B, its recombinant form is primarily used in in vitro studies to investigate receptor-ligand interactions and signaling pathways.

Key Research Applications

  • SDS-PAGE: Used to confirm protein purity and structural integrity .

  • Ligand Binding Studies: Analogous to human ADRA2B, which binds antagonists like yohimbine and prazosin with high affinity (e.g., Kd = 0.33 nM for rauwolscine) .

  • Pathway Analysis: Involvement in GPCR signaling, particularly G alpha (i) pathways, and interactions with guanine nucleotide-binding proteins .

Comparative Analysis with Other Species

The Amblysomus ADRA2B is part of a broader family of alpha-2B receptors studied across mammals. Below is a comparison with related recombinant proteins:

SpeciesUniProt IDExpression SystemTagApplicationsSource
Amblysomus hottentotusO18935E. coliHisSDS-PAGE, structural studies
Homo sapiensP18089Mammalian cellsHis/Fc/AviPharmacological assays, desensitization studies
Mus musculusP18089E. coli/YeastHisLigand binding, GPCR signaling

Hypertension and Salt Sensitivity

Studies in rodents demonstrate that ADRA2B inhibition reverses salt-induced hypertension. For example, antisense oligonucleotides targeting ADRA2B in rats reduced blood pressure by 35 mmHg, highlighting its role in central blood pressure regulation . While the Amblysomus protein is not directly used in these models, its structural homology to human ADRA2B makes it a valuable tool for studying receptor function.

Genetic Variants and Desensitization

A deletion variant in human ADRA2B (Δ301–303) reduces receptor phosphorylation and desensitization, potentially linking it to obesity and metabolic dysregulation . The recombinant Amblysomus protein could serve as a control in studies comparing wild-type and variant receptor behaviors.

Emotional Memory and Pharmacogenetics

A deletion polymorphism in human ADRA2B is associated with enhanced negative emotional memory, particularly in response to antidepressants like reboxetine . This underscores the receptor’s role in neuropsychiatric conditions, an area where recombinant ADRA2B may aid in mechanistic studies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Amblysomus hottentotus (Hottentot golden mole)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHMWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSNRRGPRAKGATREGESKLPHPMAAGASASAKPPTLTSSLAVAGEANGHSKP TGEEGETLEDPVTSTLPPSWPALPNSDQGQKEGVCETSPEEDDEEEECGPQAVPVSPASA GSPPLQQPQGSRVLATLRGQVLLGRGVGAAGGQWWRRRTQLTREKRFTFVLAVVIGVFVL CWFPFFFSYSLGAICPQHCKVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression system is typically used for recombinant Amblysomus hottentotus ADRA2B?

Recombinant ADRA2B from Amblysomus hottentotus is commonly expressed in E. coli expression systems. The recombinant protein is typically fused to an N-terminal His tag to facilitate purification and detection in experimental applications .

What is the functional significance of the Alpha-2B adrenergic receptor?

The Alpha-2B adrenergic receptor (ADRA2B) is involved in the regulation of norepinephrine availability in the nervous system. It plays critical roles in various physiological and cognitive processes, including attention, memory, and emotional processing. Research has shown that genetic variations in this receptor can influence cognitive processing of emotional information and response inhibition capabilities .

What are the optimal storage conditions for recombinant ADRA2B protein?

For optimal preservation of recombinant ADRA2B:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, prepare working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol (recommended final concentration: 50%) and store at -20°C/-80°C

How should recombinant ADRA2B protein be reconstituted for experimental use?

The recommended reconstitution protocol includes:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Prepare multiple aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity

What analytical methods are suitable for confirming the purity and identity of recombinant ADRA2B?

Several complementary analytical approaches can be employed:

  • SDS-PAGE: For purity assessment (typically >90% purity is expected)

  • Western blotting: For identity confirmation using anti-His tag or specific anti-ADRA2B antibodies

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Functional binding assays: To confirm the activity of the recombinant receptor

What SNPs have been identified in the ADRA2B gene with functional significance?

Several key SNPs in the ADRA2B gene have been identified with potential functional significance:

  • rs2312955: Located in the downstream region

  • rs3813662: Located in the single exon region

  • rs2229169: Located in the coding region, serves as proxy SNP for common functional polymorphisms

  • rs4426564: Located in the coding region

  • rs1168965: Located in the promoter region

These SNPs form a conserved haplotype block, with the common haplotypes AAGG and CCAC (rs2312955∣rs2229169∣rs4426564∣rs1168965) occurring at frequencies of approximately 0.47 and 0.53, respectively .

How does the deletion variant in ADRA2B affect cognitive processing?

The deletion variant in the ADRA2B gene has been associated with:

A meta-analysis of 16 published studies with 2,752 participants has established that carriers of the ADRA2B deletion variant show enhanced processing of emotional information. This effect appears to be moderated by several factors, including the type of cognitive process being studied (memory vs. attention/perception) and specific task procedures (recall vs. recognition) .

What is the relationship between ADRA2B haplotypes and response inhibition?

Research has demonstrated significant genetic effects of ADRA2B conserved haplotype polymorphisms on response inhibition, as measured by stop-signal reaction time (SSRT). A study with 421 healthy Chinese participants found:

  • Individuals with the AAGG/AAGG genotype (n=89) had significantly shorter SSRTs (mean=170.2 ms)

  • Compared to those with CCAC/AAGG genotype (n=216; mean=182.4 ms)

  • And those with CCAC/CCAC genotype (n=116; mean=195.8 ms)

These findings suggest that ADRA2B genetic variations contribute to individual differences in the ability to inhibit inappropriate or irrelevant responses, a key component of executive function .

How can recombinant ADRA2B be utilized in receptor-ligand binding studies?

For receptor-ligand binding experiments:

  • Reconstitute the purified recombinant ADRA2B protein according to recommended protocols

  • Incorporate the receptor into an appropriate membrane system or use detergent-solubilized protein

  • Use radioligand binding assays with selective alpha-2 adrenergic receptor ligands

  • Analyze binding kinetics and affinity parameters using Scatchard analysis or similar methods

  • Compare binding properties with other adrenergic receptor subtypes to establish selectivity

What methodological approaches can resolve contradictory findings in ADRA2B genetic studies?

To address contradictions in ADRA2B genetic association studies:

  • Conduct full haplotype analysis rather than focusing on single polymorphisms

  • Increase statistical power through larger, well-characterized cohorts

  • Stratify analyses by ethnicity to account for population-specific genetic architectures

  • Incorporate task-specific moderating variables identified in meta-analyses

  • Use standardized cognitive tasks with well-defined parameters

  • Consider gene-environment interactions, particularly those involving stress exposure

  • Apply multilevel modeling approaches to integrate findings across studies

How does the ADRA2B deletion variant interact with stress responses in cognitive processing?

The interaction between the ADRA2B deletion variant and stress responses is complex:

  • The deletion variant appears to enhance emotional memory encoding and retrieval

  • Under stress conditions, carriers of the deletion variant may show a more pronounced shift from "cognitive" to "habit" memory systems

  • This genetic variation may modulate the neural correlates of successful emotional memory formation

  • The effect appears to be specific to emotional content rather than general cognitive processing

  • These interactions have implications for understanding individual differences in resilience and stress-related disorders

These findings suggest that the ADRA2B deletion variant plays a role in determining how stress affects cognitive processing, particularly in emotional contexts .

What control conditions should be included when studying ADRA2B-mediated effects on emotional processing?

A robust experimental design should include:

  • Neutral stimuli control conditions to differentiate general cognitive effects from emotion-specific effects

  • Comparison of different emotional valences (positive vs. negative) to detect valence-specific effects

  • Non-adrenergic receptor controls to establish specificity of observed effects

  • Time-course measurements to capture potential differences in early versus late processing

  • Inclusion of both ADRA2B deletion carriers and non-carriers to establish genotype-dependent effects

  • Consideration of task-specific factors (memory vs. attention/perception, recall vs. recognition)

How can researchers detect potential artifacts in ADRA2B functional studies?

To identify and minimize artifacts in ADRA2B studies:

  • Confirm protein quality before experiments through multiple analytical methods

  • Include appropriate negative controls (e.g., denatured protein, unrelated receptors)

  • Verify that observed effects are blocked by selective ADRA2B antagonists

  • Perform dose-response experiments to establish biological relevance

  • Cross-validate findings using multiple experimental approaches

  • Consider potential confounds such as post-translational modifications or aggregation state of the recombinant protein

What factors should be considered when comparing results across different ADRA2B genetic studies?

When comparing findings across ADRA2B genetic studies, researchers should consider:

  • Population differences in allele frequencies and haplotype structures

  • Variations in genotyping methods and SNP selection

  • Differences in cognitive tasks and emotional stimuli used

  • Sample size and statistical power considerations

  • Potential gene-gene and gene-environment interactions

  • Moderating factors such as targeted cognitive processes and task procedures

  • Publication bias favoring positive findings

Meta-analytical approaches with multilevel modeling have proven useful for synthesizing findings across diverse studies and identifying consistent patterns in this field .

How might ADRA2B research contribute to understanding mechanisms of emotional resilience?

ADRA2B research offers several promising avenues for investigating emotional resilience mechanisms:

  • Examining how ADRA2B genetic variations influence stress reactivity and recovery

  • Investigating the role of noradrenergic modulation in adaptive emotional processing

  • Exploring potential interactions between ADRA2B and other genetic factors involved in emotional regulation

  • Studying age-related changes in noradrenergic modulation of emotional memory

  • Developing computational models of how noradrenergic systems influence cognitive-emotional interactions under varying stress conditions

What novel methodological approaches could advance ADRA2B functional characterization?

Emerging methodologies that could enhance ADRA2B research include:

  • CRISPR-Cas9 gene editing to introduce specific ADRA2B variants in cellular models

  • Advanced imaging techniques combining fMRI with PET to correlate receptor expression with functional activity

  • Single-cell RNA sequencing to characterize cell-type specific expression patterns

  • Computational modeling of receptor-ligand interactions based on structural data

  • Optogenetic approaches to precisely control noradrenergic signaling during cognitive tasks

  • Development of bispecific antibodies or nanobodies for highly selective receptor targeting

How can ADRA2B research be translated to clinical applications?

Potential translational pathways for ADRA2B research include:

  • Pharmacogenetic approaches to predict individual responses to adrenergic drugs

  • Development of targeted interventions for emotional processing biases in psychiatric disorders

  • Identification of at-risk individuals based on genetic profiles for preventive interventions

  • Design of cognitive training programs tailored to ADRA2B genotype

  • Integration of ADRA2B genotyping in personalized treatment approaches for stress-related disorders

  • Development of novel therapeutic compounds with enhanced specificity for ADRA2B receptor subtypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.