Recombinant Ambystoma tigrinum Cytochrome b (mt-cyb)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Cytochrome b, encoded by the mt-cyb gene, is the sole mitochondrial DNA-encoded subunit of Complex III in the electron transport chain. In Ambystoma tigrinum, this protein facilitates electron transfer during oxidative phosphorylation, enabling ATP production . Its recombinant form is engineered for structural, functional, or evolutionary studies, leveraging the species’ genetic diversity and phylogenetic significance in salamander research .

Recombinant Protein Characteristics

The recombinant Ambystoma tigrinum Cytochrome b is produced via bacterial expression systems, optimized for purity and solubility. Key features include:

ParameterDetails
Expression SystemE. coli (in vitro)
TagN-terminal 10xHis-tag
Sequence CoverageFull-length (1–102 amino acids)
UniProt AccessionP34860
Sequence ExampleFGSLLGLCLITQILTGLFLAMHYTADTSSAFSSVAHICRDVNYGWLMRNIHANGASFFFI CIFLHIGRGMYYGSYMFKETWNIGVILLFLVMATAFVGYVLP...

Phylogenetic Utility

Ambystoma tigrinum is frequently studied in salamander hybridization research, where mt-cyb serves as a mitochondrial marker for genetic divergence. For example, a 2020 study analyzed mt-cyb sequences to assess hybridization patterns, highlighting its role in evolutionary biology . While the recombinant protein itself is not directly cited in these studies, its availability supports downstream applications such as:

  • Structural Analysis: Elucidating cytochrome b’s transmembrane domains and electron transfer mechanisms.

  • Biochemical Assays: Studying Complex III assembly or interactions with ubiquinone.

Biochemical and Functional Studies

The recombinant protein facilitates research into:

  • Complex III Deficiency: Insights into mitochondrial disorders linked to cytochrome b mutations, though this is more relevant to human studies .

  • Species-Specific Adaptations: Comparing A. tigrinum cytochrome b to homologs in other species to identify evolutionary pressures.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-cyb; cob; cytb; mtcyb; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Ambystoma tigrinum (Eastern tiger salamander)
Target Names
Target Protein Sequence
FGSLLGLCLITQILTGLFLAMHYTADTSSAFSSVAHICRDVNYGWLMRNIHANGASFFFI CIFLHIGRGMYYGSYMFKETWNIGVILLFLVMATAFVGYVLP
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Ambystoma tigrinum Cytochrome b and what is its function in mitochondria?

Recombinant Ambystoma tigrinum Cytochrome b (mt-cyb) is a mitochondrial protein derived from Eastern tiger salamanders. Functionally, it serves as a core subunit (MT-CYB) of Complex III in the oxidative phosphorylation system. The protein is predominantly hydrophobic, consisting of eight transmembrane helices and containing two heme groups . It forms two ubiquinol and inhibitor binding sites, called Qo and Qi sites, which are critical for electron transport chain function .

Methodologically, researchers should approach cytochrome b as more than just a protein component - it represents a central element in mitochondrial energy production. The protein functions as part of Complex III, a main site of proton gradient generation and energy conservation, while also being a significant source of reactive oxygen species (ROS) production . These ROS can serve dual roles, acting both in beneficial signaling pathways coordinating nuclear-mitochondrial responses and potentially damaging cellular components, leading to cell death .

How is Recombinant Ambystoma tigrinum Cytochrome b typically stored and handled in laboratory settings?

For optimal research outcomes, Recombinant Ambystoma tigrinum Cytochrome b requires specific storage and handling protocols. The shelf life depends on multiple factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability . Liquid preparations generally maintain viability for approximately 6 months at -20°C/-80°C, while lyophilized forms can remain stable for up to 12 months at the same temperatures .

When working with this protein, researchers should avoid repeated freeze-thaw cycles, which can compromise structural integrity and activity. For working aliquots, storage at 4°C is acceptable for up to one week . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. For reconstitution, deionized sterile water should be used to create a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) recommended for long-term storage aliquots . The standard final concentration of glycerol is typically 50%, though researchers may adjust this based on specific experimental requirements .

What experimental models are appropriate for studying Ambystoma tigrinum Cytochrome b function?

While direct manipulation of salamander mitochondrial DNA presents significant challenges, yeast models offer a valuable alternative for studying mt-cyb function. Yeast systems are particularly advantageous because they are amenable to mitochondrial transformation, allowing researchers to introduce human-associated (or salamander-associated) point mutations into yeast mtDNA . This approach enables comprehensive biochemical and biophysical analyses of the resulting mitochondrial mutants.

This methodological approach has been successfully employed to assess the impact of disease mutations on Complex III function and to explore potential compensation mechanisms in cases with severe respiratory function defects . Additionally, yeast models provide an accessible system for characterizing acquired resistance mutations in mt-cyb following drug treatments targeting Complex III, or for investigating the structural basis of differential inhibitor sensitivity . For researchers interested in Ambystoma tigrinum Cytochrome b, adapting these yeast-based methodologies could yield valuable functional insights without requiring direct genetic manipulation of salamander mitochondria.

What techniques are most effective for measuring the effects of Ambystoma tigrinum Cytochrome b variants on Complex III activity?

Based on established methodologies for studying cytochrome b variants, researchers should employ a multi-parameter approach to comprehensively assess Complex III activity changes in Ambystoma tigrinum Cytochrome b variants. The yeast model system offers particular advantages, as it allows for controlled introduction of specific mutations followed by detailed biochemical characterization .

Methodologically, the following techniques provide robust assessment of functional impacts:

For more advanced analysis, researchers can employ techniques such as Blue Native PAGE to assess complex assembly, proteomic approaches to identify compensatory changes in other respiratory components, and structural biology methods to determine how specific variations affect the three-dimensional conformation of the protein. This comprehensive approach allows for detailed characterization of how specific amino acid changes in salamander mt-cyb might affect Complex III function, potentially revealing unique adaptations in amphibian mitochondrial energy metabolism.

What role does Ambystoma tigrinum Cytochrome b play in the salamander's immune response to viral infections like ATV?

During ATV infection, axolotls mount a robust innate immune response detectable through gene expression changes as early as 24 hours post-infection . By 24 hours, transcripts associated with phagocytosis, cytokine signaling, complement activation, and general immune and defense responses show significant changes . By 144 hours, gene expression shifts toward host-mediated cell death, inflammation, and cytotoxicity mechanisms . Notably, the most highly upregulated gene at 144 hours post-infection was interferon-induced protein with tetracopeptide repeats 5 (IFIT5), showing a 91-fold increase .

While Cytochrome b was not specifically highlighted in these immune response studies, mitochondrial function is increasingly recognized as crucial for proper immune responses. Methodologically, researchers interested in exploring this connection should design experiments that simultaneously track changes in mt-cyb expression/activity and immune parameters during infection. This could include measuring changes in Complex III activity, ROS production, and ATP generation alongside immune markers. Such studies might reveal whether alterations in mitochondrial function, particularly involving cytochrome b, represent a response mechanism or contribute to pathogenesis during salamander viral infections.

What protocols yield the highest purity and activity for recombinant expression of Ambystoma tigrinum Cytochrome b?

For optimal recombinant expression of Ambystoma tigrinum Cytochrome b, researchers should consider baculovirus expression systems, which have demonstrated success in producing functional mitochondrial proteins . This approach allows for proper post-translational modifications and folding that may be critical for maintaining the protein's native structure and activity.

When implementing this methodology, researchers should focus on achieving purification levels exceeding 85% as assessed by SDS-PAGE . The following protocol elements are critical:

  • Vector design should incorporate appropriate tags to facilitate purification while minimizing interference with protein function

  • Expression conditions must be optimized for temperature, induction time, and media composition

  • Purification strategies typically involve affinity chromatography followed by size exclusion and/or ion exchange steps

  • Quality control should include activity assays specific to Complex III function

  • Protein stability should be assessed under various storage conditions

It's important to note that tag selection may impact protein function and should be determined during the manufacturing process based on specific experimental requirements . For verification of functional integrity, researchers should conduct spectroscopic analyses to confirm proper heme incorporation and electron transfer capabilities. Additionally, reconstitution into liposomes or nanodiscs may be necessary for functional studies of this membrane protein, as its hydrophobic nature can complicate handling in aqueous solutions.

How can researchers effectively introduce specific mutations into Ambystoma tigrinum Cytochrome b for functional studies?

While direct genetic manipulation of salamander mitochondrial DNA presents significant challenges, researchers can employ alternative methodological approaches to study the functional consequences of specific mutations in Ambystoma tigrinum Cytochrome b. Based on established techniques for studying mt-cyb variations, the following strategies are recommended:

  • Yeast Model System: Following the approach used for human mt-cyb variants, researchers can introduce salamander-specific mutations into yeast mtDNA . This system allows for controlled genetic manipulation and comprehensive biochemical characterization.

  • Protocol Elements:

    • Identify conserved functional domains between salamander and yeast cytochrome b

    • Design mutation constructs that replicate salamander-specific variations

    • Perform mitochondrial transformation in yeast using established protocols

    • Verify mutation introduction through sequencing

    • Assess phenotypic and biochemical consequences through respiratory growth, enzyme activity, and drug sensitivity assays

  • Validation Approaches:

    • Compare results with wild-type controls using oxygen consumption measurements

    • Evaluate complex assembly using Blue Native PAGE

    • Assess electron transfer kinetics using spectrophotometric assays

    • Test drug sensitivity profiles to identify altered binding properties

This heterologous expression system provides a practical alternative to direct manipulation of salamander mtDNA, allowing researchers to investigate structure-function relationships in Ambystoma tigrinum Cytochrome b. For further validation, results from yeast studies can be compared with biochemical analyses of native protein isolated from salamander tissues, providing insights into any species-specific functional adaptations.

What techniques can be used to assess the interaction between Ambystoma tigrinum Cytochrome b and inhibitors or drug compounds?

For comprehensive assessment of interactions between Ambystoma tigrinum Cytochrome b and inhibitors or drug compounds, researchers should employ multiple complementary techniques focusing on both binding and functional consequences. Based on established approaches in cytochrome b research, the following methodological framework is recommended:

  • Yeast-based functional assays: By introducing salamander cytochrome b sequences into yeast mtDNA, researchers can test drug sensitivity through growth inhibition assays . This approach has successfully revealed altered drug sensitivities in human mt-cyb variants, such as increased sensitivity to atovaquone with the p.Asp171Asn mutation and enhanced sensitivity to clomipramine with the p.Phe18Leu mutation .

  • Spectroscopic analyses: UV-visible spectroscopy can detect changes in heme absorption spectra upon inhibitor binding, while electron paramagnetic resonance (EPR) spectroscopy can provide insights into changes in the electronic environment of the hemes.

  • Enzyme kinetics: Measuring Complex III activity in the presence of varying inhibitor concentrations allows determination of inhibition constants (Ki) and inhibition mechanisms (competitive, non-competitive, or uncompetitive).

  • Binding affinity measurements: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can provide direct measurements of binding constants and thermodynamic parameters.

  • Computational approaches: Molecular docking and molecular dynamics simulations can predict binding modes and identify key interaction residues when structural information is available.

By combining these approaches, researchers can develop comprehensive inhibitor profiles, identifying compounds that specifically interact with Ambystoma tigrinum Cytochrome b and potentially revealing unique binding properties compared to cytochrome b from other species.

How do gene expression patterns of Ambystoma tigrinum Cytochrome b change during immune responses to pathogens?

While the search results don't directly address changes in Ambystoma tigrinum Cytochrome b expression during immune responses, data from related studies on amphibian responses to viral infection provide context for understanding potential patterns. Research on axolotls (Ambystoma mexicanum) infected with Ambystoma tigrinum virus (ATV) revealed significant gene expression changes across multiple timepoints post-infection .

The methodological approach for analyzing such expression patterns typically involves:

  • RNA extraction from relevant tissues (e.g., spleen, lung) at defined timepoints post-infection

  • cDNA synthesis followed by microarray analysis or RNA-seq

  • Identification of differentially expressed genes using statistical methods

  • Functional annotation and clustering to identify biological processes affected

  • Validation of key genes via qPCR

In the ATV infection study, 158 genes were significantly up-regulated while 105 were down-regulated across all timepoints . Functional clustering revealed enrichment in several biological processes including immune response, innate immunity, complement activation, and lysosome function . Of particular relevance to mitochondrial function, researchers should note that while many immunity-related genes were upregulated, genes associated with cell division and mitosis were predominantly downregulated , suggesting a potential metabolic shift that could involve changes in mitochondrial gene expression.

For researchers studying Ambystoma tigrinum Cytochrome b specifically, a similar methodological approach focused on mitochondrial gene expression could reveal how this protein's expression changes during immune challenges, potentially contributing to energy metabolism adaptations required for effective immune responses.

What are the implications of Ambystoma tigrinum Cytochrome b variations for evolutionary studies and conservation efforts?

Cytochrome b has historically served as an important marker for evolutionary studies due to its relatively conserved nature with sufficient variability to resolve phylogenetic relationships. For Ambystoma tigrinum, analysis of mt-cyb variations can provide valuable insights with implications for both evolutionary biology and conservation efforts.

From a methodological perspective, researchers should approach this question through:

  • Comparative sequence analysis across populations to identify:

    • Conservation hotspots suggesting functional constraints

    • Variable regions that may reflect adaptive evolution

    • Population-specific variants that could indicate local adaptation

  • Functional testing of variants to determine:

    • Whether variations affect Complex III activity or efficiency

    • If certain variants confer selective advantages in specific environments

    • Whether variations impact susceptibility to environmental stressors

  • Population genetics analyses to assess:

    • Gene flow between populations

    • Genetic diversity within threatened populations

    • Evidence of selection pressures acting on mt-cyb

For conservation applications, mt-cyb variation data can help identify evolutionary significant units within the species, guide breeding programs to maintain genetic diversity, and potentially identify populations with unique adaptations worth prioritizing for conservation. Additionally, understanding the functional consequences of naturally occurring variations could provide insights into the species' capacity to adapt to changing environmental conditions, including emerging pathogens like ATV that have caused significant population declines in some salamander species .

How can researchers interpret conflicting data regarding the functional impact of specific Ambystoma tigrinum Cytochrome b mutations?

When confronted with conflicting data regarding functional impacts of Ambystoma tigrinum Cytochrome b mutations, researchers should employ a systematic approach to resolve discrepancies. Based on established practices in the field of mitochondrial research, the following methodological framework is recommended:

  • Context-dependent effects analysis:

    • Evaluate experimental systems used (in vivo vs. in vitro)

    • Compare genetic backgrounds (wild-type vs. pre-existing mutations)

    • Assess environmental conditions (temperature, pH, oxidative stress)

  • Methodological cross-validation:

    • Apply multiple independent techniques to measure the same parameter

    • Test function across different levels (protein activity, complex assembly, cellular respiration)

    • Use both in vitro biochemical assays and in vivo functional assessments

  • Dose-response relationships:

    • Determine if heteroplasmy levels (mutation load) affect functional outcomes

    • Create models with controlled mutation levels to establish threshold effects

  • Interaction analysis:

    • Investigate whether other genetic factors modify the mutation's impact

    • Assess environmental influences on phenotypic expression

    • Consider potential compensatory mechanisms

The yeast model system offers particular advantages for resolving conflicting data, as it allows for controlled genetic manipulation and comprehensive phenotypic assessment . By systematically varying experimental conditions while maintaining genetic consistency, researchers can identify context-dependent effects that might explain apparently contradictory results. Additionally, technologies like site-directed mutagenesis in combination with diverse functional assays can help establish causal relationships between specific mutations and observed phenotypes.

Comparison of Key Catalytic Domains in Cytochrome b and Their Functions

DomainLocationFunctionImpact of MutationsResearch Method
Qi siteInner membrane facing matrixUbiquinone reduction, inhibitor bindingp.Phe18Leu increases clomipramine sensitivityYeast growth inhibition assays, enzyme kinetics
Qo siteIntermembrane space interfaceUbiquinol oxidation, inhibitor bindingp.Asp171Asn increases atovaquone sensitivityYeast growth inhibition assays, enzyme kinetics
Heme binding regionsTransmembrane helicesElectron transferCan affect catalytic activity and complex stabilitySpectroscopic analysis, activity assays
Transmembrane domainsSpans inner membraneComplex structural integrityMay affect assembly or stabilityBlue Native PAGE, structural analysis

Gene Expression Changes in Amphibians Following Viral Infection

Time Post-infectionUpregulated ProcessesDownregulated ProcessesNotable GenesFold Change
24 hoursImmune response, phagocytosis, cytokine signaling, complement activation-23 genes with ≥2-fold change, all upregulated2-5 fold
72 hoursContinued immune response, inflammationCell division, mitosis43 genes with ≥5-fold change5-20 fold
144 hoursHost-mediated cell death, inflammation, cytotoxicityCell division, mitosisInterferon-induced protein with tetracopeptide repeats 5 (IFIT5)Up to 91-fold

Data derived from axolotl (Ambystoma mexicanum) response to Ambystoma tigrinum virus infection

Storage and Handling Recommendations for Recombinant Ambystoma tigrinum Cytochrome b

FormStorage TemperatureShelf LifeHandling RecommendationsReconstitution Protocol
Liquid-20°C/-80°C6 monthsAvoid repeated freeze-thaw cyclesNot applicable
Lyophilized-20°C/-80°C12 monthsCentrifuge vial before opening0.1-1.0 mg/mL in deionized sterile water
Working aliquots4°CUp to 1 weekMinimize exposure to room temperatureNot applicable
Long-term storage-20°C/-80°CAs per formAdd 5-50% glycerol (typically 50%)As per reconstitution

Data derived from product information for Recombinant Ambystoma tigrinum Cytochrome b

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.