Recombinant Ambystoma tigrinum Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Ambystoma tigrinum (Eastern tiger salamander)
Target Names
RHO
Target Protein Sequence
MNGTEGPNFYVPFSNKSGVVRSPFEYPQYYLAEPWQYSVLAAYMFLLILLGFPVNFLTLY VTIQHKKLRTPLNYILLNLAFANHFMVFGGFPVTMYSSMHGYFVFGQTGCYIEGFFATMG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVMMTWIMALACAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFLVHFTIPLMIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVAFLICWVPYASVAFYIFSNQGTDFGPIFMTVPAFFAKSSAI YNPVIYIVLNKQFRNCMITTICCGKNPFGDDETTSAATSKTEASSVSSSQVSPA
Uniprot No.

Target Background

Function
A photoreceptor crucial for low-light vision and postnatal photoreceptor cell survival. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change activating G-protein signaling. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the primary structure of Ambystoma tigrinum rhodopsin?

Ambystoma tigrinum rhodopsin consists of 354 amino acids that form seven transmembrane domains characteristic of the G protein-coupled receptor superfamily. Molecular cloning studies have revealed significant sequence identity with other amphibian rhodopsins at both nucleic acid (82-83%) and amino acid (88-89%) levels. The protein retains key amino acids critical for the structure and function of rhodopsin across species. The cloned rhodopsin gene encodes a full-length coding region within a 1.2 kb cDNA isolated from larval tiger salamander retina .

How does tiger salamander rhodopsin compare to rhodopsins from other species?

Tiger salamander rhodopsin shares significant structural homology with other amphibian rhodopsins but contains species-specific variations. The hydropathy profile confirms the characteristic seven-transmembrane domain structure common to all rhodopsins. Sequence alignments show high conservation of functional domains critical for light absorption, G-protein coupling, and signal transduction. The protein maintains the core structural elements while exhibiting species-specific adaptations that may reflect evolutionary adjustments to particular visual environments and ecological niches .

What is the cellular expression pattern of rhodopsin in Ambystoma tigrinum?

Expression studies using single-cell RT-PCR and Southern blot analysis demonstrate that Ambystoma tigrinum rhodopsin is exclusively expressed in rod photoreceptor cells, specifically in red rods with absorption maxima (λmax) at 506 nm. Microspectrophotometric measurements confirm this spectral sensitivity profile. No expression of the rhodopsin gene has been detected in cone cells, confirming the cell type-specific nature of this visual pigment. This strict expression pattern underscores the specialized role of rhodopsin in rod-mediated scotopic (low-light) vision .

How does Ambystoma tigrinum rhodopsin participate in phototransduction?

Like other rhodopsins, the tiger salamander rhodopsin functions as the primary photoreceptor molecule in rod cells, initiating the visual transduction cascade upon photon absorption. When light activates rhodopsin, it triggers conformational changes that facilitate interaction with the G-protein transducin. This activation leads to increased phosphodiesterase activity, resulting in cGMP hydrolysis and closure of cGMP-gated ion channels. The salamander model has been instrumental in understanding these processes due to its large photoreceptor cells that allow detailed electrophysiological recordings .

What is the role of calcium in regulating rhodopsin function in tiger salamander photoreceptors?

Calcium plays a critical regulatory role in salamander photoreception through calcium-binding proteins like recoverin. Research with recombinant recoverin in salamander rod outer segments demonstrates that calcium-bound recoverin (Ca-recoverin) mediates calcium-dependent inhibition of rhodopsin phosphorylation. At high calcium levels, Ca-recoverin prolongs the recovery phase of bright flash responses by inhibiting rhodopsin deactivation. This inhibition has an apparent dissociation constant (Kd) for calcium of approximately 13 μM and a Hill coefficient of 2, indicating cooperative binding. When calcium levels drop, this inhibitory effect rapidly diminishes, allowing faster rhodopsin deactivation and signal recovery .

How is Ambystoma tigrinum rhodopsin deactivated after light exposure?

Deactivation of light-activated tiger salamander rhodopsin (Rh*) occurs primarily through phosphorylation by rhodopsin kinase, followed by arrestin binding. This process is regulated by calcium-dependent mechanisms involving recoverin. At high calcium concentrations typical of dark-adapted states, recoverin inhibits rhodopsin kinase, prolonging Rh* activity. As calcium levels fall during light exposure, this inhibition is released, accelerating Rh* deactivation. This calcium-dependent regulation helps control the duration of the photoresponse and contributes to light adaptation mechanisms in salamander photoreceptors .

What are the optimal methods for cloning and expressing recombinant Ambystoma tigrinum rhodopsin?

The established methodology for cloning salamander rhodopsin involves:

  • Extraction of high-quality RNA from fresh salamander retina

  • Reverse transcription using primers designed from conserved regions of amphibian rhodopsins (particularly Xenopus rhodopsin sequences)

  • PCR amplification of rhodopsin cDNA fragments

  • Construction and screening of a cDNA library from salamander retina

  • Isolation and sequencing of full-length clones using the dideoxynucleotide chain termination method

For heterologous expression, mammalian cell lines (typically HEK293 or COS-7) transfected with expression vectors containing the full-length rhodopsin coding sequence have proven successful. The addition of 11-cis-retinal during expression enhances proper protein folding and function .

What spectroscopic techniques are most informative for analyzing Ambystoma tigrinum rhodopsin properties?

Several spectroscopic approaches have proven valuable for characterizing tiger salamander rhodopsin:

  • Microspectrophotometry: Allows measurement of absorption spectra in isolated photoreceptor cells with high spatial resolution. This technique has revealed that tiger salamander red rod outer segments have an absorption maximum (λmax) at 506 nm.

  • Polarized light microspectrophotometry: Enables assessment of linear dichroism, providing information about the orientation of the chromophore within the membrane. For tiger salamander rods, the average dichroic ratio at 435 nm is approximately 3.16, with a transverse specific density of 0.0115/μm.

  • Flash photolysis: Permits time-resolved measurement of rhodopsin photochemical transitions following light exposure.

These techniques, combined with protein purification and biochemical assays, provide comprehensive characterization of recombinant rhodopsin structure and function .

How can electrophysiological techniques be combined with recombinant rhodopsin studies in salamander models?

The tiger salamander preparation offers unique advantages for combining electrophysiology with molecular studies due to the large size of its photoreceptors. Key methodological approaches include:

  • Truncated rod outer segment preparation: Involves mechanically isolating the outer segment and recording membrane currents while dialyzing with solutions containing recombinant proteins. This technique has been used successfully to study the effects of recoverin on rhodopsin function.

  • Suction electrode recordings: Allow measurement of the photocurrent from intact rod photoreceptors, enabling assessment of how recombinant proteins affect the complete photoresponse.

  • Patch-clamp recording: Provides detailed analysis of the electrophysiological properties of photoreceptors and downstream neurons in response to light stimulation.

These techniques can be combined with molecular interventions, such as the introduction of recombinant proteins or pharmacological agents, to dissect specific aspects of the phototransduction cascade and rhodopsin function .

How does recombinant Ambystoma tigrinum rhodopsin compare functionally with rhodopsins from model organisms like bovine or mouse?

Functional comparative studies reveal both similarities and differences between salamander and mammalian rhodopsins:

PropertyAmbystoma tigrinum RhodopsinBovine RhodopsinMouse Rhodopsin
Absorption Maximum506 nm498 nm498 nm
Sequence IdentityReference~80% amino acid identity~79% amino acid identity
Photobleaching KineticsSlowerIntermediateFaster
G-protein Coupling EfficiencyHighHighHigh
Thermal StabilityHigherLowerLower
Phosphorylation SitesConserved C-terminal sitesWell-characterizedWell-characterized

The salamander rhodopsin exhibits somewhat red-shifted spectral sensitivity and enhanced thermal stability compared to mammalian counterparts, likely reflecting adaptations to aquatic environments and nocturnal/crepuscular activity patterns. Despite these differences, the core functional properties and activation mechanisms remain highly conserved across species .

What insights has recombinant Ambystoma tigrinum rhodopsin provided about calcium-dependent regulation of phototransduction?

Studies with salamander rhodopsin have been pivotal in elucidating calcium-dependent regulation mechanisms in phototransduction:

  • Recoverin-mediated regulation: Experiments with recombinant recoverin in salamander rod outer segments demonstrated that Ca-recoverin inhibits rhodopsin kinase, prolonging rhodopsin activation at high calcium levels. This inhibition follows a cooperative calcium dependence (Hill coefficient ~2) with half-maximal effect at ~13 μM calcium.

  • Light adaptation mechanisms: The rapid reversibility of recoverin's effect following calcium concentration decreases (occurring within <1 second) suggests this mechanism contributes to light adaptation by allowing faster rhodopsin deactivation as calcium levels fall during the photoresponse.

  • Amplification control: The system provides calcium-dependent control of signal amplification between rhodopsin and phosphodiesterase, with the effective amplification decreasing up to 7-fold between darkness and bright background illumination.

These findings highlight how calcium-dependent modulation of rhodopsin deactivation contributes to photoreceptor adaptation across different light intensities .

How can site-directed mutagenesis of recombinant Ambystoma tigrinum rhodopsin inform structure-function relationships?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in tiger salamander rhodopsin. Key applications include:

  • Chromophore binding pocket modifications: Mutations in residues forming the retinal binding pocket can alter spectral properties, providing insights into the molecular basis of wavelength sensitivity tuning in salamander vision.

  • G-protein interaction interface: Targeted modifications to cytoplasmic loops can define critical residues for transducin coupling and activation, revealing species-specific aspects of signal transduction.

  • Phosphorylation site analysis: Mutation of C-terminal serine/threonine residues can elucidate the specific roles of different phosphorylation sites in rhodopsin deactivation and arrestin binding.

  • Calcium-dependent regulation: Mutations affecting interaction with calcium-binding proteins like recoverin can reveal the molecular mechanisms underlying calcium-dependent regulation of rhodopsin function.

These approaches, combined with functional assays, can illuminate how specific structural features contribute to the unique properties of salamander rhodopsin .

What are the main challenges in producing functional recombinant Ambystoma tigrinum rhodopsin?

Researchers face several technical challenges when working with recombinant salamander rhodopsin:

  • Post-translational modifications: Ensuring proper folding, glycosylation, and chromophore attachment can be challenging in heterologous expression systems. The addition of 11-cis-retinal during expression and careful selection of expression systems are critical.

  • Protein stability: Membrane proteins like rhodopsin are inherently unstable when removed from their native lipid environment. Stabilization strategies including the use of appropriate detergents, nanodiscs, or reconstitution into lipid environments may be necessary.

  • Functional assessment: Verifying that recombinant rhodopsin retains native-like photochemical properties requires specialized equipment for spectroscopic and functional analyses.

  • Species-specific factors: The salamander rhodopsin may require specific cellular machinery for optimal function that might be absent in common expression systems.

Addressing these challenges requires careful optimization of expression conditions and purification protocols specific to salamander rhodopsin .

How can researchers overcome variability in spectroscopic measurements of recombinant rhodopsin?

Variability in spectroscopic measurements presents a significant challenge in rhodopsin research. To minimize this variability:

  • Standardized sample preparation: Develop consistent protocols for cell culture, protein expression, and purification to reduce batch-to-batch variation.

  • Internal standards and controls: Include well-characterized reference samples in each experimental set to normalize between measurements.

  • Multiple measurement approaches: Combine different spectroscopic techniques (absorption, fluorescence, circular dichroism) to build a more comprehensive and robust dataset.

  • Temperature control: Maintain strict temperature regulation during measurements, as rhodopsin spectral properties can be temperature-dependent.

  • Dark adaptation protocols: Standardize dark adaptation periods before measurements to ensure consistent rhodopsin states.

  • Statistical analysis: Apply appropriate statistical methods to account for measurement variability and determine confidence intervals for spectroscopic parameters.

Implementation of these approaches can significantly improve the reliability and reproducibility of spectroscopic data for recombinant salamander rhodopsin .

What considerations are important when designing experiments using recombinant Ambystoma tigrinum rhodopsin in electrophysiological studies?

When incorporating recombinant salamander rhodopsin into electrophysiological experiments, researchers should consider:

  • Concentration effects: Titrate the concentration of recombinant protein carefully, as excessive levels may produce non-physiological effects. For instance, in truncated rod outer segment experiments, recoverin concentrations of 5-20 μM have provided physiologically relevant results.

  • Temporal dynamics: Allow sufficient time for equilibration after introducing recombinant proteins into the experimental system. The time required can vary depending on the protein and delivery method.

  • Control experiments: Include appropriate controls, such as heat-inactivated proteins or binding-deficient mutants, to verify specific effects.

  • Species compatibility: Consider whether the recombinant salamander protein will interact appropriately with components from other species if used in heterologous systems.

  • Solution composition: Pay careful attention to ionic conditions, particularly calcium concentration, as many rhodopsin-interacting proteins (like recoverin) are calcium-sensitive.

  • Light history: Control the light exposure history of the preparation carefully, as this affects the state of the photoreceptors and their response to experimental manipulations.

Addressing these considerations can enhance the physiological relevance and interpretability of electrophysiological experiments involving recombinant salamander rhodopsin .

How might comparative studies between salamander rhodopsin and other visual pigments inform evolutionary adaptations in visual systems?

Comparative analysis between Ambystoma tigrinum rhodopsin and other visual pigments presents exciting opportunities for evolutionary research:

  • Adaptation to different light environments: Comparing salamander rhodopsin with visual pigments from species inhabiting different light environments (deep sea, terrestrial, nocturnal, diurnal) could reveal adaptive molecular mechanisms for spectral tuning.

  • Evolutionary transitions: Studying rhodopsins across amphibians at different stages of terrestrialization could illuminate the molecular adaptations accompanying the water-to-land transition in vertebrate evolution.

  • Functional convergence and divergence: Comparing salamander rhodopsin with recently discovered pigments like xenopsin (found in protostome eyes) could reveal instances of convergent evolution in photoreceptor molecules.

  • Molecular basis of spectral sensitivity: Identifying the specific amino acid substitutions responsible for spectral differences between salamander rhodopsin (λmax 506 nm) and other visual pigments could enhance our understanding of the structure-function relationships in opsin proteins.

These comparative approaches could provide significant insights into the evolutionary forces shaping visual systems across diverse environments and phylogenetic lineages .

What potential applications exist for recombinant Ambystoma tigrinum rhodopsin in optogenetic tools?

Salamander rhodopsin offers several promising characteristics for development as an optogenetic tool:

  • Spectral properties: With an absorption maximum at 506 nm, salamander rhodopsin could expand the available spectral range of optogenetic actuators, potentially allowing multiplexed control when combined with other tools.

  • Thermal stability: The relatively high thermal stability of salamander rhodopsin might enable more reliable function in mammalian expression systems at physiological temperatures.

  • Signaling versatility: Engineering chimeric proteins combining salamander rhodopsin with various G-protein coupling domains could create tools with diverse signaling outputs.

  • Calcium sensitivity integration: Incorporating the calcium-dependent regulatory mechanisms observed in salamander visual transduction could enable development of optogenetic tools with activity-dependent properties.

Future research could focus on optimizing expression, membrane targeting, and kinetic properties to develop salamander rhodopsin-based optogenetic tools with unique capabilities for neuroscience applications .

How might high-resolution structural studies of Ambystoma tigrinum rhodopsin enhance our understanding of GPCR activation mechanisms?

High-resolution structural studies of salamander rhodopsin would provide valuable comparative data to existing GPCR structures:

  • Species-specific activation mechanisms: Structural studies could reveal how subtle sequence differences between salamander and mammalian rhodopsins impact activation mechanisms and conformational changes.

  • Environmental adaptations: The structural basis for adaptations to aquatic environments and specific light conditions could be identified through comparative structural analysis.

  • Dynamic regulation: Time-resolved structural studies could provide insights into the molecular mechanisms of calcium-dependent regulation through proteins like recoverin.

  • Ligand binding dynamics: Studies of retinal-protein interactions in salamander rhodopsin might reveal novel aspects of chromophore-protein relationships in GPCRs.

  • Allosteric modulation sites: Identification of structural features unique to salamander rhodopsin could reveal novel sites for allosteric modulation that might be applicable across the GPCR family.

These structural insights could significantly enhance our understanding of GPCR activation mechanisms and provide templates for the design of novel pharmaceuticals targeting other members of this important receptor family .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.