Recombinant Amia calva Cytochrome c oxidase subunit 1 (mt-co1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this requirement in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Amia calva (Bowfin)
Target Names
Target Protein Sequence
QHLFWFFGHPEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHH MFTVGMDVDTRAYFTSATMVIAIPTGVKVFSWLATLHGGAIKWETPLLWALGFIFLFTVG GLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLHPTWSK IHFGVMFV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (mt-co1) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. The active site, a binuclear center (BNC), is formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is MT-CO1 and what is its functional significance in cellular metabolism?

    MT-CO1, also known as mitochondrially encoded cytochrome c oxidase I, is an integral component of the mitochondrial electron transport chain. Encoded by the MT-CO1 gene, it functions within complex IV on the mitochondrial inner membrane. MT-CO1 primarily catalyzes the transfer of electrons to oxygen, producing water and facilitating ATP synthesis, which is essential for cellular energy metabolism . This protein contains multiple functional domains that enable copper ion binding and heme binding activities, which are critical for its oxidoreduction-driven active transmembrane transporter functions . The significance of MT-CO1 extends beyond basic metabolism, as dysfunction of this protein has been associated with various pathological conditions including neurodegenerative disorders, muscle diseases, and cardiomyopathies .

  • What experimental techniques commonly employ recombinant MT-CO1?

    Recombinant MT-CO1 is utilized in multiple experimental techniques across molecular and cellular biology research. Primary applications include:

    • Immunological assays: Recombinant MT-CO1 serves as an antigen for antibody production and validation. It is used in ELISA, immunohistochemistry (IHC), and immunofluorescence (IF) applications to detect and quantify MT-CO1 expression in various tissues and cell types .

    • Enzymatic activity assays: The protein is employed in functional studies to measure cytochrome c oxidase activity, particularly in investigating mitochondrial respiratory chain efficiency.

    • Protein-protein interaction studies: Recombinant MT-CO1 is used to identify binding partners within the respiratory complex and other potential interactors.

    • Structural biology: The purified protein facilitates structural characterization of mitochondrial respiratory components.

    The validation data from MT-CO1 antibodies shows successful application in multiple techniques, including immunohistochemistry of human ovarian and prostate cancer tissues, and immunofluorescent analysis of HeLa cells .

  • How does MT-CO1 contribute to species identification through DNA barcoding?

    MT-CO1 serves as a standard genetic marker for DNA barcoding due to its consistent sequence divergence patterns across species. The process involves:

    1. Isolation of mitochondrial DNA from tissue samples

    2. PCR amplification of the MT-CO1 gene region

    3. Sequencing of the amplified product

    4. Comparative analysis against reference databases

    This method is particularly valuable because MT-CO1 exhibits low intraspecific variation (within species) but high interspecific variation (between species), creating a "barcode gap" that enables reliable differentiation . The phylogenetic analysis typically employs computational methods such as:

    • Calculation of genetic distances using the Kimura 2 Parameter method

    • Construction of Neighbor Joining trees to visualize relationships

    • Maximum likelihood analysis for evolutionary relationship assessment

    DNA barcoding through MT-CO1 offers greater reliability compared to traditional morphological identification methods, particularly when dealing with closely related species or specimens with ambiguous physical characteristics .

  • What characterizes the structure and expression pattern of MT-CO1?

    MT-CO1 is characterized by a complex protein structure that includes multiple transmembrane domains and cofactor binding sites essential for its electron transport function. In model organisms like zebrafish (Danio rerio), MT-CO1 exhibits specific expression patterns across various tissues and developmental stages . The protein is localized to the mitochondrial inner membrane and forms part of respiratory chain complex IV .

    Expression studies in zebrafish have documented MT-CO1 presence in:

    • Female and male organisms

    • Gill tissues

    • Liver

    • Musculature system

    The protein is predicted to enable multiple molecular functions, including:

    • Copper ion binding

    • Heme binding

    • Oxidoreduction-driven active transmembrane transport

    MT-CO1 has been shown to respond to environmental stressors, specifically acting upstream of or within response pathways to cadmium ion and methylmercury exposure , indicating its potential role in cellular stress responses beyond its primary function in oxidative phosphorylation.

Advanced Research Questions

  • How does downregulation of MT-CO1 contribute to radioresistance in cancer cells?

    Downregulation of MT-CO1 has been identified as a mechanism leading to radioresistance in esophageal squamous cell carcinoma. This process involves multiple cellular pathways:

    MT-CO1 downregulation inhibits the apoptotic response normally triggered by radiation through disruption of the caspase cascade activation pathway. In a study using transposon-based gene screening to identify radioresistant genes, MT-CO1 was detected in three radioresistant colonies . The research demonstrated that:

    • MT-CO1-downregulated cells showed significantly higher survival rates after irradiation compared to parent cells (28.7% vs. 10.5% at day 9 after 5-Gy irradiation, P<0.001)

    • The activity of cytochrome c and caspase-3 following irradiation was significantly lower in MT-CO1-downregulated radioresistant cells

    • While survival rates continued to decrease in parent cells after irradiation, they increased in MT-CO1-downregulated cells at day 9

    This mechanism suggests that MT-CO1 functions as a sensitivity factor for radiation therapy, and its downregulation may represent a cellular adaptation that increases cancer cell survival following radiotherapy . These findings have significant implications for developing strategies to overcome radioresistance in cancer treatment.

  • What methodologies are most effective for investigating MT-CO1 variants and their clinical significance?

    Investigating MT-CO1 variants requires a comprehensive methodological approach that integrates molecular, cellular, and clinical analyses:

    Molecular characterization:

    • Next-generation sequencing of mitochondrial DNA to identify variants

    • Site-directed mutagenesis to recreate variants in experimental systems

    • Computational prediction of variant effects using tools like ACMG guidelines

    Functional assessment:

    • Oxygen consumption measurements to quantify respiratory chain function

    • Cytochrome c release assays to evaluate apoptotic potential

    • Measurement of ATP production to assess energetic consequences

    Clinical correlation:

    • Case-control studies comparing variant frequencies in patient cohorts

    • Family studies to establish inheritance patterns

    • Correlation with clinical phenotypes

    An example of this approach is seen in the clinical evaluation of the NC_012920.1(MT-CO1):m.7362G>A variant, which was classified as "uncertain significance" for Leigh syndrome . The classification utilized modified ACMG guidelines and specifically noted the BP4 evidence code, suggesting multiple layers of analysis to determine potential pathogenicity .

  • How can researchers differentiate between the functional impacts of various MT-CO1 mutations?

    Differentiating functional impacts of MT-CO1 mutations requires systematic approaches that combine:

    Biochemical assays:

    • Enzyme activity measurements comparing wild-type and mutant proteins

    • Spectroscopic analyses to assess heme incorporation and electron transfer capabilities

    • Protein stability assessments to determine if mutations affect protein folding or degradation rates

    Cellular models:

    • Cybrid cell lines incorporating patient-derived mitochondria with specific mutations

    • CRISPR-engineered cell lines with defined mutations

    • Measurement of cellular consequences including ATP production, ROS formation, and apoptotic sensitivity

    Structural biology approaches:

    • Comparative structural modeling based on known cytochrome c oxidase structures

    • Identification of how mutations might affect critical domains or interaction surfaces

    For example, the variant NC_012920.1(MT-CO1):m.7362G>A results in a p.Glu487Lys substitution that requires careful assessment of its impact on protein function . Mutations affecting copper binding sites or proton channels would be expected to have more severe functional consequences than those in less conserved regions of the protein.

  • What experimental designs best capture the role of MT-CO1 in the mitochondrial apoptotic pathway?

    Optimal experimental designs for investigating MT-CO1's role in apoptosis include:

    Genetic manipulation approaches:

    • RNA interference (siRNA/shRNA) targeting MT-CO1

    • CRISPR-Cas9 mediated genetic modification

    • Overexpression systems using recombinant MT-CO1

    Apoptotic pathway analysis:

    • Measurement of cytochrome c release from mitochondria

    • Caspase activity assays (particularly caspase-3)

    • TUNEL assays to detect DNA fragmentation

    • Annexin V/PI staining for flow cytometric analysis of apoptotic populations

    Stress response evaluations:

    • Radiation exposure (as demonstrated in esophageal cancer studies)

    • Chemical inducers of apoptosis (e.g., staurosporine, etoposide)

    • Hypoxia/reoxygenation challenges

    The study of MT-CO1 downregulation in radioresistant cancer cells effectively employed this multifaceted approach, demonstrating that MT-CO1 downregulation resulted in:

    • Reduced cytochrome c activity after irradiation

    • Decreased caspase-3 activation

    • Significantly increased cell survival following radiation exposure

    These findings established a direct link between MT-CO1 expression levels and apoptotic potential, highlighting the importance of comprehensive experimental designs that capture multiple aspects of the apoptotic response.

  • How do sequence variations in Amia calva MT-CO1 compare with other species for evolutionary and phylogenetic studies?

    Sequence analysis of Amia calva MT-CO1 reveals important evolutionary relationships when compared with other species:

    The Amia calva MT-CO1 partial protein sequence (188 amino acids) contains highly conserved functional domains common to cytochrome c oxidase subunit 1 across species . Comparative analysis typically involves:

    • Multiple sequence alignment to identify conserved and variable regions

    • Calculation of sequence similarity percentages between species

    • Identification of signature sequences that may be unique to particular lineages

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    DNA barcoding studies utilizing MT-CO1 sequences employ computational analysis methods such as:

    • Calculation of genetic distances using the Kimura 2 Parameter method

    • Construction of Neighbor Joining trees to visualize relationships

    • Analysis of branch support through bootstrap testing

    These approaches allow researchers to place Amia calva (a primitive ray-finned fish) in its proper evolutionary context within vertebrate phylogeny, and to understand how structural and functional constraints have shaped the evolution of this essential respiratory protein across different lineages.

  • What are the methodological considerations for using MT-CO1 antibodies in complex tissue samples?

    Utilizing MT-CO1 antibodies for research in complex tissue samples requires careful methodological considerations:

    Antibody selection and validation:

    Several MT-CO1 antibodies are commercially available with different applications and species reactivity. Researchers should select antibodies validated for their specific application and target species:

    CodeProduct NameSpecies ReactivityApplication
    CSB-PA015072LA01HUMT-CO1 AntibodyHumanELISA, IHC, IF
    CSB-PA015072LB01HUMT-CO1 Antibody, HRP conjugatedHumanELISA
    CSB-PA015072LD01HUMT-CO1 Antibody, Biotin conjugatedHumanELISA
    CSB-PA868168XA01DILmt-co1 AntibodyDanio rerio (Zebrafish)ELISA, WB

    Optimization of protocols:

    • Appropriate dilution determination (e.g., 1:100 for IHC and IF applications as demonstrated in validated data)

    • Antigen retrieval method selection for formalin-fixed tissues

    • Blocking optimization to reduce background

    • Incubation time and temperature adjustments

    Controls and specificity verification:

    • Positive control tissues with known MT-CO1 expression

    • Negative controls omitting primary antibody

    • Peptide competition assays to confirm specificity

    • Correlation with other mitochondrial markers

    Quantification approaches:

    • Digital image analysis for IHC quantification

    • Fluorescence intensity measurement for IF applications

    • Normalization to appropriate housekeeping proteins or total protein content

    Successful application of MT-CO1 antibodies has been demonstrated in human ovarian and prostate cancer tissues using immunohistochemistry and in HeLa cells using immunofluorescence , providing a methodological foundation for researchers working with this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.