Recombinant Ammi majus Psoralen synthase (CYP71AJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP71AJ1; Psoralen synthase; Cytochrome P450 CYP71AJ1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Ammi majus (Bishop's weed)
Target Names
CYP71AJ1
Target Protein Sequence
MKMLEQNPQYLYFFSLFLVTIFLYKWLTLKKTPLKNLPPSPPQYPIIGNLHQIGPDPQAS LRDLAQKYGPLMFLKFGTVPVLVVSSADAAREALKTHDLVFADRPYSSVANKIFYNGKDM VFARYTEYWRQVKSICVTQLLSNKRVNSFHYVREEEVDLLVQNLENSHSKVANLTELLIE VTGNVVCRVSVGSGDKVDSYKILILEIMDMLGYSRSIEDFFPLLGWVDWLTGLRGKVAEA AKGVDTFLEGVLKEHLSTTGSKYNDFVSILLEIQEADAGSSMDNECIKSLIWDMLGAGTE TISTALEWTLAALIKNPDAMFKLQNEVREIGKGKSKISEADLVKMNYLQAVMKESMRLYF TAPLLVPREARQDIKFMGYDISSGTQVLINAWAIARDPLLWDKPEEFRPERFLNSPIDYK GFHYEFLPFGAGRRGCPGIQFAMCINELVVANLVHKFNFELPDGKRLEDLDMTAASGITL RKKSPLLVVARPHV
Uniprot No.

Target Background

Function
Recombinant Ammi majus Psoralen Synthase (CYP71AJ1) is involved in linear furanocoumarin (psoralen) biosynthesis, catalyzing the conversion of marmesin to psoralen.
Database Links

KEGG: ag:AAT06911

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.

Q&A

What is CYP71AJ1 and what is its primary function in furanocoumarin biosynthesis?

CYP71AJ1 is a cytochrome P450 monooxygenase isolated from Ammi majus L. that functions as psoralen synthase in the biosynthetic pathway of linear furanocoumarins. This enzyme catalyzes the conversion of (+)-marmesin to psoralen, which represents a critical step in furanocoumarin biosynthesis. The enzyme is part of a larger metabolic pathway where linear furanocoumarins are produced through a CYP-dependent conversion sequence beginning with 6-prenylumbelliferone, proceeding through (+)-marmesin as an intermediate, and ultimately yielding psoralen . The reaction catalyzed by CYP71AJ1 involves an oxidative C-C bond cleavage that results in the formation of psoralen and acetone as products. This type of cleavage reaction is analogous to reactions catalyzed by other cytochrome P450 enzymes that perform oxidative bond cleavages in diverse plant biosynthetic pathways.

How was CYP71AJ1 originally identified and characterized?

The identification of CYP71AJ1 was accomplished through a carefully designed molecular cloning approach targeting elicitor-responsive genes in Ammi majus cell cultures. Researchers used a nested DD-RT-PCR (Differential Display Reverse Transcription Polymerase Chain Reaction) strategy with CYP-specific primers to clone expressed sequence tags (ESTs) from elicited Ammi cells . The research team correlated the abundance profiles of these ESTs with the induction pattern of furanocoumarin-specific enzyme activities to identify candidate genes.

CYP71AJ1 was identified as a transcript displaying maximal abundance at 4 hours post-elicitation, coinciding with the early stages of furanocoumarin biosynthesis activation . Full-size cDNAs were subsequently generated from fragments that showed correlation with the induction profile of psoralen synthase activity. Functional characterization required expression in heterologous systems, which initially proved challenging but was eventually accomplished by engineering a chimeric construct where the N-terminal membrane anchor domain of CYP71AJ1 was replaced with that of CYP73A1, enabling successful expression in yeast cells .

What is the substrate specificity profile of CYP71AJ1?

CYP71AJ1 demonstrates relatively narrow substrate specificity, primarily catalyzing the conversion of (+)-marmesin to psoralen. This specificity is characteristic of many specialized metabolism enzymes in plants that have evolved to perform precise biochemical transformations in complex biosynthetic pathways. The enzyme recognizes the structural features of (+)-marmesin, including its furanocoumarin skeleton and the specific stereochemistry of the prenyl-derived side chain.

When comparing CYP71AJ1's substrate specificity with other P450 enzymes involved in similar reactions, such as CYP82G1 from Arabidopsis (which converts terpenoid alcohols to homoterpenes), notable differences in substrate recognition are observed. While CYP82G1 can accept both (E,E)-geranyllinalool and (E)-nerolidol as substrates, it shows no activity toward substrates with different stereochemistry or functional group positioning . This pattern of narrow substrate specificity appears to be a shared characteristic among P450 enzymes involved in specialized metabolic pathways, reflecting their evolutionary optimization for specific biosynthetic roles.

What are the typical expression patterns and induction characteristics of CYP71AJ1?

CYP71AJ1 exhibits a distinctive expression pattern that aligns with its role in defense-related furanocoumarin biosynthesis. In Ammi majus cell cultures, CYP71AJ1 is typically expressed at negligible background levels under normal conditions but shows rapid and significant induction upon elicitation . This induction pattern represents a classic example of how plants dynamically regulate specialized metabolic pathways in response to environmental stresses.

The enzyme activity profile shows transient maxima at 9-10 hours post-elicitation, with the CYP71AJ1 transcript reaching maximal abundance earlier, at approximately 4 hours after elicitor treatment . This temporal separation between peak transcript levels and maximum enzyme activity represents the expected lag between transcription and the assembly of functional enzyme complexes in the endoplasmic reticulum membrane. The rapid induction from negligible background levels suggests tight transcriptional control, likely involving jasmonate-dependent signaling pathways similar to those observed for other defense-related P450 enzymes.

What are the major challenges in heterologous expression of functional CYP71AJ1?

The heterologous expression of functional plant cytochrome P450 enzymes presents several technical challenges, which were evidenced in the case of CYP71AJ1. Initial attempts to express CYP71AJ1 in Escherichia coli or yeast cells failed to produce functional enzyme . These difficulties are common when working with membrane-bound P450 enzymes and typically stem from several factors:

Membrane integration issues represent the primary challenge, as plant P450s contain N-terminal membrane anchor domains that may not properly integrate into heterologous membranes. For CYP71AJ1, researchers overcame this obstacle by creating a chimeric construct where the N-terminal membrane anchor domain was replaced with that of CYP73A1 . This domain-swapping approach has proven effective for other plant P450s and highlights the importance of membrane integration for proper folding and function.

Additional challenges include differences in codon usage, post-translational modification capabilities, redox partner compatibility, and the potential for protein misfolding or aggregation in heterologous systems. The successful expression strategy for CYP71AJ1 involved not only membrane domain swapping but also careful selection of the expression host and optimization of culture conditions to maximize functional protein yield.

What are the kinetic parameters of CYP71AJ1 and how do they compare to related enzymes?

The kinetic properties of CYP71AJ1 provide insights into its catalytic efficiency and substrate affinity. While the search results don't provide direct kinetic parameters for CYP71AJ1, they do offer a comparative reference in relation to CYP82G1 from Arabidopsis. CYP82G1, which catalyzes an analogous cleavage reaction but with different substrates, has been kinetically characterized with the following parameters:

SubstrateK<sub>m</sub> (μM)V<sub>max</sub> (pkat/mg)k<sub>cat</sub> (s<sup>-1</sup>)k<sub>cat</sub>/K<sub>m</sub> (s<sup>-1</sup>/μM)
(3RS)-(E,E)-geranyllinalool2.68 ± 0.7116.37 ± 0.780.11 ± 0.010.05 ± 0.01
(3S)-(E)-nerolidol1.84 ± 0.1129.09 ± 1.390.20 ± 0.010.11 ± 0.01

What is the proposed catalytic mechanism of CYP71AJ1?

The catalytic mechanism of CYP71AJ1 involves an oxidative C-C bond cleavage reaction that converts (+)-marmesin to psoralen with the concurrent release of acetone. Based on what is known about similar P450-catalyzed reactions, the mechanism likely proceeds through the following steps:

  • Substrate binding within the active site, with the marmesin molecule positioned such that the bond to be cleaved is in proximity to the heme iron center.

  • Oxygen activation by the heme iron, forming the reactive iron-oxo species that serves as the oxidizing agent.

  • Hydrogen abstraction from the substrate, potentially from a position adjacent to the C-C bond that will be cleaved.

  • Radical rearrangement and bond cleavage, resulting in the formation of psoralen and acetone.

This mechanism is analogous to the one proposed for CYP82G1, which performs a similar cleavage reaction on terpenoid alcohols. For CYP82G1, computational modeling predicted a binding mode where the substrate hydroxyl group faces the I-helix, enabling a catalytic mechanism involving syn-elimination of the polar head together with an allylic hydrogen atom . The reaction of CYP71AJ1 with (+)-marmesin similarly results in an equimolar mixture of psoralen and acetone , suggesting a comparable mechanistic pathway despite the differences in substrate structure.

How does CYP71AJ1 relate structurally and functionally to other P450 enzymes in plant specialized metabolism?

CYP71AJ1 belongs to the CYP71 clan, one of the largest and most diverse groups of plant cytochrome P450 enzymes, primarily involved in specialized metabolism. While direct structural information for CYP71AJ1 is not provided in the search results, its functional characteristics can be compared with those of other characterized P450 enzymes.

CYP82G1 from Arabidopsis, for example, belongs to the CYP82 family within the same CYP71 clan . Despite being in different families, both enzymes catalyze analogous oxidative C-C bond cleavage reactions, suggesting some conservation of catalytic machinery within the clan. CYP82G1 converts terpenoid alcohols to homoterpenes, while CYP71AJ1 converts (+)-marmesin to psoralen.

The functional diversity within the CYP71 clan is remarkable, with members catalyzing various reactions including hydroxylations, dealkylations, and C-C bond cleavages. For instance, tobacco CYP82E4v1 and CYP82E5v2 catalyze oxidative N-demethylation reactions in nicotine metabolism, whereas Arabidopsis CYP82C2 and CYP82C4 can hydroxylate 8-methoxypsoralen . This functional diversity highlights the evolutionary plasticity of P450 enzymes in adapting to various biosynthetic roles in plant specialized metabolism.

What experimental approaches are most effective for studying the regulation of CYP71AJ1 expression?

Investigating the regulation of CYP71AJ1 expression requires a combination of molecular, biochemical, and physiological approaches. Based on successful strategies mentioned in the search results, the following experimental approaches would be most effective:

  • Elicitor-based induction studies: Treating Ammi majus cell cultures with elicitors like alamethicin (as used for CYP82G1 studies ) can trigger the induction of CYP71AJ1. Time-course experiments monitoring transcript abundance and enzyme activity provide insights into the kinetics of induction.

  • Transcript profiling: Techniques such as quantitative RT-PCR, microarray analysis, or RNA-seq can be used to monitor changes in CYP71AJ1 transcript levels under various conditions or in different tissues. These approaches allow for comprehensive analysis of expression patterns and co-regulated genes.

  • Promoter analysis: Cloning and characterization of the CYP71AJ1 promoter region, followed by deletion analysis and reporter gene assays, can identify key regulatory elements controlling gene expression. This approach was instrumental in understanding the regulation of other defense-related P450 genes.

  • Signaling pathway dissection: Using specific inhibitors of signaling pathways or mutants defective in signaling components (such as the COI1-dependent jasmonate signaling pathway investigated for CYP82G1 ) can help determine the upstream regulators controlling CYP71AJ1 expression.

  • Co-expression analysis: In silico screening of co-expressed genes, as performed for identifying CYP82G1's role in terpene metabolism , can provide insights into the regulatory networks controlling CYP71AJ1 expression and potentially identify transcription factors involved in its regulation.

What are the optimal conditions for assaying CYP71AJ1 enzyme activity in vitro?

Establishing optimal assay conditions for CYP71AJ1 requires careful consideration of several parameters to ensure reliable and reproducible activity measurements. Based on standard practices for P450 enzyme assays and information from related enzymes, the following conditions are recommended:

  • Enzyme preparation: CYP71AJ1 activity is best recovered in microsomal fractions from either elicited plant tissues or heterologous expression systems . For heterologously expressed enzyme, microsomes should be prepared from yeast cells expressing the chimeric construct with the N-terminal anchor from CYP73A1 .

  • Buffer composition: A typical reaction buffer would contain 50-100 mM potassium phosphate (pH 7.0-7.5), supplemented with 1-5 mM DTT or β-mercaptoethanol to maintain reducing conditions. The addition of 10-20% glycerol can help stabilize the enzyme.

  • Cofactor requirements: As a P450 enzyme, CYP71AJ1 requires NADPH as a cofactor. An NADPH-regenerating system (containing glucose-6-phosphate, glucose-6-phosphate dehydrogenase, and NADP+) can be included to maintain cofactor levels during longer incubations.

  • Substrate concentration: Based on the comparative kinetic data with CYP82G1, substrate concentrations spanning 0.5-10× the K<sub>m</sub> value (approximately 1-30 μM) would be appropriate for determining kinetic parameters .

  • Detection method: Product formation can be monitored using HPLC or GC-MS methods optimized for psoralen detection. For kinetic studies, initial velocity conditions should be established by determining the linear range of product formation with time.

How can genetic engineering be used to improve CYP71AJ1 expression or activity?

Genetic engineering approaches offer several strategies for enhancing CYP71AJ1 expression or catalytic properties for research or biotechnological applications:

What are the key considerations for designing experiments to study CYP71AJ1 in planta?

Investigating CYP71AJ1 function in intact plants presents distinct challenges and opportunities compared to in vitro studies. Key considerations for designing effective in planta experiments include:

  • Tissue specificity: Determining the spatial expression pattern of CYP71AJ1 within Ammi majus tissues is essential for targeted sampling. Furanocoumarin biosynthesis often occurs in specific tissues, particularly those associated with defense responses or specialized secretory structures.

  • Developmental timing: CYP71AJ1 expression may vary throughout plant development. Temporal expression analysis across different growth stages can identify optimal timepoints for studying the enzyme under natural conditions.

  • Induction protocols: Establishing reliable methods for inducing CYP71AJ1 expression is crucial. This might include applying elicitors (e.g., alamethicin, methyl jasmonate, or fungal extracts), mechanical wounding, or herbivore feeding to trigger defense responses .

  • Genetic manipulation: Developing transformation protocols for Ammi majus would enable overexpression, silencing, or CRISPR-based knockout studies to directly assess CYP71AJ1 function. Alternatively, heterologous expression in model plants like Arabidopsis or tobacco can provide insights into enzyme function in a plant cellular context.

  • Metabolite analysis: Comprehensive profiling of furanocoumarins and pathway intermediates using LC-MS or GC-MS methods can reveal the metabolic consequences of manipulating CYP71AJ1 expression. Stable isotope labeling approaches can provide additional information on flux through the pathway.

How does CYP71AJ1 compare with other enzymes involved in furanocoumarin biosynthesis?

CYP71AJ1 is part of a multi-step biosynthetic pathway leading to the production of linear furanocoumarins in Ammi majus. Its relationship with other enzymes in this pathway reveals important insights about the organization and regulation of specialized metabolism:

  • Pathway position: CYP71AJ1 catalyzes a late-stage reaction in furanocoumarin biosynthesis, converting (+)-marmesin to psoralen . This positioning is typical for P450 enzymes that catalyze decorating or finalizing reactions in specialized metabolic pathways.

  • Induction coordination: The expression pattern of CYP71AJ1 is likely coordinated with other enzymes in the pathway, particularly those catalyzing upstream reactions. This coordinated induction ensures efficient flux through the pathway when defense responses are triggered.

  • Enzyme specificity: Compared to some other enzymes in plant specialized metabolism that can accept multiple substrates, CYP71AJ1 appears to have relatively narrow substrate specificity, reflecting its specialized role in furanocoumarin biosynthesis .

  • Catalytic mechanism: The oxidative C-C bond cleavage catalyzed by CYP71AJ1 represents a mechanistically distinct reaction compared to the hydroxylations, O-methylations, and prenylations performed by other enzymes in the pathway. This reaction diversity highlights the versatility of plant biosynthetic machinery.

What are the potential applications of recombinant CYP71AJ1 in biotechnology and metabolic engineering?

Recombinant CYP71AJ1 offers several promising applications in biotechnology and metabolic engineering, particularly in the context of producing bioactive furanocoumarins:

  • Biocatalytic production of psoralen: The ability of CYP71AJ1 to convert (+)-marmesin to psoralen could be harnessed for in vitro enzymatic production of this medicinally important compound, potentially providing a more environmentally friendly alternative to chemical synthesis.

  • Metabolic engineering of furanocoumarin pathways: Introducing CYP71AJ1 into heterologous plant hosts alongside other furanocoumarin biosynthetic genes could enable the production of psoralen and derived compounds in non-native hosts with better growth characteristics or amenability to large-scale cultivation.

  • Enzyme evolution platforms: CYP71AJ1 could serve as a starting point for directed evolution experiments aimed at generating novel enzymes with altered substrate specificity or regioselectivity, potentially enabling the biosynthesis of non-natural furanocoumarin derivatives with enhanced properties.

  • Biosensor development: The substrate specificity of CYP71AJ1 could be exploited to develop biosensors for detecting (+)-marmesin or related compounds in complex biological samples, which could have applications in quality control for medicinal plants or natural products.

What techniques are most effective for analyzing the structural basis of CYP71AJ1 substrate recognition?

Understanding the structural determinants of CYP71AJ1 substrate recognition requires a combination of computational and experimental approaches:

  • Homology modeling: Since no crystal structure is available for CYP71AJ1, homology modeling based on structurally characterized P450 enzymes represents a practical starting point. This approach was successfully applied to CYP82G1 , where models were built using multiple mammalian P450 structures as templates.

  • Molecular docking: In silico docking of (+)-marmesin into the active site of the homology model can predict substrate binding modes and identify potential substrate-enzyme interactions. This approach helped elucidate the binding orientation of substrates for CYP82G1 .

  • Site-directed mutagenesis: Systematic mutation of residues predicted to be involved in substrate binding, followed by kinetic characterization, can experimentally validate computational predictions and identify critical determinants of specificity.

  • Substrate analog studies: Testing the activity of CYP71AJ1 against a series of substrate analogs with systematic structural variations can provide insights into the structural features required for recognition and positioning within the active site.

  • Protein crystallography: While challenging for membrane-bound P450 enzymes, X-ray crystallography of CYP71AJ1 (possibly with N-terminal modifications to enhance solubility) would provide the most definitive structural information, particularly if co-crystallized with substrates or substrate analogs.

What are the most promising avenues for advancing our understanding of CYP71AJ1 and furanocoumarin biosynthesis?

Several research directions offer significant potential for expanding our knowledge of CYP71AJ1 and its role in furanocoumarin biosynthesis:

  • Structural biology approaches: Determining the three-dimensional structure of CYP71AJ1 would provide unprecedented insights into its catalytic mechanism and substrate specificity. Advances in cryo-electron microscopy and membrane protein crystallography make this an increasingly feasible goal.

  • Systems biology integration: Placing CYP71AJ1 within the broader context of plant stress responses using transcriptomic, proteomic, and metabolomic approaches would enhance our understanding of how furanocoumarin biosynthesis is coordinated with other defense mechanisms.

  • Comparative genomics: Examining CYP71AJ1 homologs across furanocoumarin-producing plant species could reveal evolutionary patterns and potentially identify novel enzymes with related but distinct functions in specialized metabolism.

  • Synthetic biology applications: Reconstituting the complete furanocoumarin biosynthetic pathway in heterologous hosts would not only validate our understanding of the pathway but also enable biotechnological production of these valuable compounds.

  • Ecological function studies: Investigating the roles of CYP71AJ1-dependent furanocoumarins in plant-insect and plant-microbe interactions would provide a broader context for understanding the ecological significance of these specialized metabolites.

What emerging technologies might enhance future research on CYP71AJ1?

Emerging technologies across multiple disciplines offer exciting possibilities for advancing CYP71AJ1 research:

  • CRISPR/Cas9 genome editing: Precise manipulation of CYP71AJ1 in Ammi majus and related species would enable detailed functional studies in planta. Multiplexed editing could target multiple pathway genes simultaneously to dissect pathway interactions.

  • Single-cell technologies: Single-cell transcriptomics and metabolomics could reveal cell-type-specific expression patterns and metabolite profiles, providing insights into the spatial organization of furanocoumarin biosynthesis within plant tissues.

  • Nanobody-based tools: Developing nanobodies against CYP71AJ1 could enable protein visualization, purification, and potentially modulation of activity in vivo, offering new approaches for studying this membrane-bound enzyme.

  • Microfluidic enzyme assays: High-throughput microfluidic platforms for enzyme kinetics would facilitate rapid screening of substrate analogs or enzyme variants, accelerating both basic research and enzyme engineering efforts.

  • Computational approaches: Advanced molecular dynamics simulations, quantum mechanics/molecular mechanics (QM/MM) calculations, and machine learning approaches could provide deeper insights into catalytic mechanisms and guide rational enzyme engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.