Recombinant Amoebophilus asiaticus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior communication and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidC; Aasi_0237; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Amoebophilus asiaticus (strain 5a2)
Target Names
yidC
Target Protein Sequence
MDKNKLIGLILISILLIVYTHFFDNKLPKTSQQTTTQEVAHNTSNIQLQTSEATLNLQTG IFAKATQGVTKDIILENKDIRVTLSSHGAKVKEVILKQYKDYLGKPLKLLDEQSTNMGFQ FTSNQASINTNTLFFNTDDTDQYIQQASIGKVTFMIPLGEPNQYLQQVYTLPSEGYALTQ NWEFVGTENYIDQGKIDFVWHDFIKRAEKDVQACRNKTTINYYLANKTFKHLKEHTEQKE EQTIQTPIQWLAIKQRFFTAGIFTDQPFESGNILLKPTTQPDKFVKEAYTTVSLASNNLQ PIQKGTFRFYFGPNTYKDLNSFAQGFSKNLPLGWPIVKWINLYLIIPIFSFIEKYVSNYG LVILILVIFIKLLLLPLSYKSYISMAEMKVLKPTLDALKAKYGNDMQSVQMEQVKLYREM GINPLSGCIPVLLQMPILLAMFNFFPNAIDLRQKAFLWAPDLSTYDAIINLPFQIPFYGS HVSLFTLLMTASTILYTWSSNQVNTPQGPMKTMSYLLPITFMFILNSFPAGLSFYYFVSN LFTFAQQALIKRFVNEDKIKAKLAKNKEKSANNKEGSFKKRFQDAIKASASHKGKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of YidC insertase in Amoebophilus asiaticus?

YidC insertase in bacterial systems, including those found in A. asiaticus, typically features a conserved core of five transmembrane helices (TM2-TM6) arranged in a pentagonal structure. Based on structural modeling using evolutionary co-variation analysis, these helices are arranged in the order 4-5-3-2-6 when viewed from the cytoplasm . A distinctive feature is the cytoplasmic helical hairpin domain (HPD) located between TM2 and TM3, which plays a crucial role in substrate binding . The structure is stabilized by both hydrophobic interactions on the exterior of the transmembrane bundle (interacting with lipid tails) and internal interactions between helices that involve polar or charged residues toward the cytoplasmic side and aromatic residues toward the periplasmic side .

How does Amoebophilus asiaticus YidC compare to YidC homologs in other bacterial species?

While the search results don't specifically compare A. asiaticus YidC to other bacterial homologs, studies on E. coli YidC provide insights into conserved features. All YidC family members share a conserved core domain comprised of multiple transmembrane helices and a cytoplasmic helical hairpin . This structural conservation suggests functional similarity across bacterial species. The cytoplasmic α-helical hairpin appears in all YidC homologues and represents one of the most flexible regions of the insertase . The core transmembrane domain architecture is likely preserved in A. asiaticus YidC, though species-specific variations may exist in non-conserved regions, potentially reflecting adaptations to the intracellular lifestyle of A. asiaticus within amoeba hosts .

What expression systems are most effective for producing recombinant A. asiaticus YidC?

Based on approaches used for similar membrane proteins, the optimal expression of recombinant A. asiaticus YidC likely requires bacterial expression systems optimized for membrane proteins. While the search results don't specifically address A. asiaticus YidC expression, research on E. coli YidC indicates that recombinant expression can be achieved using standard bacterial expression systems . For functional studies, purification protocols typically involve detergent solubilization followed by affinity chromatography. The purified protein can then be fluorescently labeled for binding assays or reconstituted into lipid-based nanodiscs for structural and functional studies in a membrane-like environment .

What are the critical parameters for maintaining structural integrity during purification of recombinant YidC?

Maintaining the structural integrity of membrane proteins like YidC requires careful attention to several parameters:

  • Detergent selection: Mild detergents that preserve native protein folding are essential

  • Buffer composition: pH, ionic strength, and presence of stabilizing agents affect stability

  • Temperature control: Low temperatures typically reduce protein denaturation

  • Lipid environment: Reconstitution into nanodiscs provides a native-like membrane environment

For functional studies, YidC can be reconstituted into lipid-based nanodiscs composed of defined lipid mixtures, typically using a 3:1 ratio of POPE to POPG, which has been successfully employed for modeling bacterial membranes in multiple studies . This reconstitution approach maintains the protein in a functional state suitable for interaction studies with ribosomes and nascent chains .

How does YidC interact with ribosome-nascent chain complexes during membrane protein insertion?

YidC interacts specifically with ribosomes exposing hydrophobic nascent transmembrane domains (TMDs). The interaction of YidC with translating ribosomes represents an essential stage in co-translational membrane protein insertion, facilitating direct partitioning of hydrophobic nascent chains into the membrane . Several key findings regarding this interaction include:

  • A single YidC monomer interacts with translating ribosomes in both detergent and lipid bilayer environments, representing the functional insertase unit .

  • The binding efficiency reaches maximum levels once the nascent transmembrane domain is fully exposed outside the ribosomal tunnel, though weaker binding may occur at earlier stages of translation .

  • The positively charged C-terminus and a short cytoplasmic loop connecting TM4 and TM5 facilitate ribosome binding, with YidC variants lacking the C-terminus (YidCΔC) showing impaired ribosome interaction .

  • The conformational changes in YidC upon substrate binding include tilting of transmembrane helices TM2 and TM3 (by 9° and 20° respectively), which widens the central groove, while the amphipathic helix EH1 shifts from the membrane interface into the apolar membrane core .

What functional assays can be used to evaluate YidC insertase activity?

Several functional assays can be employed to evaluate YidC insertase activity:

  • Ribosome binding assays: Using fluorescently labeled YidC reconstituted into nanodiscs to measure binding to stalled ribosomes with varying nascent chain lengths .

  • Membrane insertion assays: Monitoring the insertion of model transmembrane domains into lipid bilayers in both fluid and gel phase membranes .

  • Conformational change analysis: Using cryo-electron microscopy and fluorescence analysis to detect structural changes in YidC upon substrate binding and insertion .

  • In vivo complementation assays: Testing the ability of YidC mutants to complement YidC deficiency in bacterial cells, providing functional relevance of specific residues .

  • Single-molecule force spectroscopy: Combining with fluorescence spectroscopy approaches to monitor binding and insertion of single transmembrane proteins in real-time .

Assay TypeTimeframeKey MeasurementReference
Initial substrate binding~2 msBinding of cytoplasmic α-helical hairpin to substrate polypeptide
Substrate interaction strengthening~52 msEnhanced binding stability
Conformational changeVariableTilting of TM2 (9°) and TM3 (20°)

Which residues in YidC are critical for its membrane protein insertase function?

Molecular dynamics simulations and in vivo complementation assays have identified several critical residues in YidC that are essential for function:

  • T362 in TM2 and Y517 in TM6: Located at the same height in the membrane, these residues completely inactivate YidC when mutated to alanine, despite stable expression of the mutant proteins .

  • F433, M471, and F505: Residues located close to the T362-Y517 pair show intermediate activity levels when mutated .

  • Residues in the hydrophobic core: The YidC core is stabilized by both short and long-range interactions between the five helices, with polar or charged residues toward the cytoplasmic side engaged in electrostatic interactions, and aromatic residues on the periplasmic side involved in stacking and nonpolar dispersion interactions .

The conservation of these critical residues across species suggests they play fundamental roles in the insertase mechanism, likely being preserved in A. asiaticus YidC as well.

How do membrane properties affect YidC insertase function?

YidC function is influenced by the properties of the surrounding membrane environment:

  • Lipid composition: Successful modeling of bacterial membranes for YidC function typically uses a 3:1 ratio of POPE to POPG lipids .

  • Membrane phase: YidC efficiently catalyzes membrane insertion of nascent transmembrane domains in both fluid and gel phase membranes, demonstrating remarkable adaptability to different membrane physical states .

  • Membrane thickness: YidC activity can cause local membrane thinning, which may facilitate insertion of transmembrane domains. Analysis of membrane thickness has been performed using molecular dynamics simulations to identify regions where YidC interaction alters the lipid bilayer structure .

  • Lipid-protein interactions: The exterior of the YidC transmembrane bundle interacts with lipid tails through hydrophobic residues, stabilizing the protein within the membrane .

What are the primary challenges in working with recombinant A. asiaticus YidC?

Working with A. asiaticus YidC presents several challenges inherent to both membrane proteins and the nature of A. asiaticus as an obligate intracellular symbiont:

  • Source limitations: A. asiaticus cannot replicate under environmental conditions outside its amoeba host , limiting direct sourcing of native protein.

  • Expression optimization: As with other membrane proteins, achieving sufficient expression levels while maintaining proper folding requires careful optimization of expression conditions.

  • Functional reconstitution: Ensuring the recombinant protein retains native activity following purification and reconstitution into membrane mimetics is critical for meaningful functional studies.

  • Verification of structural integrity: Confirming that recombinant A. asiaticus YidC adopts the proper structural conformation similar to that observed in other YidC homologs requires sophisticated structural analysis techniques.

How can researchers verify the functional state of recombinant YidC after purification?

Verification of functional activity for recombinant YidC can be approached through multiple complementary methods:

  • Ribosome binding assays: Testing the ability of purified YidC to bind to ribosomes exposing hydrophobic nascent chains, with binding affected by nascent chain length and exposure .

  • Conformational analysis: Using techniques such as circular dichroism, fluorescence spectroscopy, or limited proteolysis to assess whether the protein maintains its expected secondary structure and conformational flexibility .

  • Substrate insertion assays: Monitoring the ability of reconstituted YidC to facilitate insertion of model transmembrane domains into lipid bilayers .

  • Comparative analysis: Comparing the properties of recombinant A. asiaticus YidC with well-characterized homologs from model organisms like E. coli to confirm expected structural and functional features .

How can computational approaches enhance our understanding of YidC structure and function?

Computational approaches offer powerful tools for investigating YidC structure and function:

  • Evolutionary covariation analysis: This approach has been successfully used to predict contacts between pairs of residues, helping to build structural models of YidC . For A. asiaticus YidC, similar analysis could reveal specific adaptations related to its symbiotic lifestyle.

  • Molecular dynamics simulations: MD simulations provide insights into protein stability, flexibility, and interactions within the membrane environment. For YidC, these simulations have revealed:

    • Stability of the five-helix TM bundle

    • Flexibility of loop regions at the membrane surface

    • Interactions stabilizing the protein core

    • Membrane thinning effects

  • Integrated structural modeling: Combining data from multiple sources (covariation analysis, secondary structure prediction, cryo-EM density maps) can generate comprehensive structural models, as demonstrated for E. coli YidC .

The application of these computational approaches to A. asiaticus YidC could reveal adaptations specific to its function within the unique environment of an intracellular symbiont.

What is known about the kinetics of YidC-mediated membrane protein insertion?

Recent single-molecule studies have provided insights into the kinetics of YidC-mediated membrane protein insertion:

  • Initial binding: Within approximately 2 milliseconds, the cytoplasmic α-helical hairpin of YidC binds the polypeptide substrate with high conformational variability and kinetic stability .

  • Binding strengthening: Within approximately 52 milliseconds, YidC strengthens its binding to the substrate, suggesting a two-stage binding process .

  • Conformational changes: Upon substrate binding, YidC undergoes significant conformational changes, including tilting of transmembrane helices TM2 and TM3 (by 9° and 20° respectively) and relocation of the amphipathic helix EH1 from the membrane interface into the apolar membrane core .

These kinetic parameters highlight the dynamic nature of YidC-mediated insertion and suggest a mechanism by which YidC facilitates membrane protein integration through conformational adaptability.

What aspects of A. asiaticus YidC warrant further investigation?

Several aspects of A. asiaticus YidC merit further research:

  • Evolutionary adaptations: How has YidC in A. asiaticus evolved to function within the context of an obligate intracellular lifestyle? Comparative analysis with free-living bacterial YidC homologs could reveal adaptations specific to the intracellular environment.

  • Host-symbiont interactions: Does A. asiaticus YidC play a role in the establishment or maintenance of symbiosis with amoeba hosts? Investigation of YidC substrate specificity might reveal proteins important for symbiotic relationships.

  • Functional conservation: To what extent is the function of A. asiaticus YidC conserved compared to homologs in model organisms? Complementation studies in model systems could assess functional interchangeability.

  • Co-evolutionary relationships: How has A. asiaticus YidC co-evolved with its substrates and with the translational machinery of this obligate intracellular bacterium?

How might structural differences between A. asiaticus YidC and other bacterial homologs reflect adaptation to the intracellular lifestyle?

The obligate intracellular lifestyle of A. asiaticus may have driven specific adaptations in its YidC protein:

  • Substrate specificity: A. asiaticus YidC might exhibit altered substrate specificity compared to free-living bacterial homologs, reflecting the different membrane protein requirements of an intracellular symbiont.

  • Interaction with host factors: The structure might include adaptations that facilitate interactions with host amoeba factors or avoid recognition by host defense mechanisms.

  • Stability adaptations: The protein may show adaptations for stability within the unique physicochemical environment of the amoeba cytoplasm.

  • Efficiency optimizations: Given the reduced genome size typical of obligate symbionts, A. asiaticus YidC might show structural streamlining while maintaining essential functions.

Comparative structural analysis between A. asiaticus YidC and homologs from free-living bacteria could reveal these adaptations and provide insights into the molecular basis of obligate intracellular lifestyles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.