Recombinant Amoebophilus asiaticus UPF0365 protein Aasi_1337 (Aasi_1337)

Shipped with Ice Packs
In Stock

Description

Introduction

Amoebophilus asiaticus is an obligate intracellular bacterium belonging to the Bacteroidetes, residing within amoebae . These bacteria have garnered significant attention due to their unique interactions with host cells and their potential implications in the adaptation of bacteria to eukaryotic environments . Aasi_1337 is a protein found within A. asiaticus.

Genomic Context and Characteristics

The genome of A. asiaticus is approximately 1.89 Mbp in size and encodes 1,557 proteins . A notable feature of this bacterium is the high number of insertion sequence (IS) elements, which make up around 24% of its genes, indicating a dynamic genome structure . Despite this, the genome appears to be relatively stable from an evolutionary perspective . A. asiaticus lacks the ability to synthesize essential cofactors, nucleotides, and most amino acids de novo, highlighting its dependence on the host amoeba for these nutrients .

Protein Aasi_1337

Aasi_1337 is annotated as a UPF0365 protein within Amoebophilus asiaticus . UPF0365 proteins are conserved proteins of unknown function and are found in bacteria. Amoebophilus asiaticus possesses a putative prophage, showing similarity to the antifeeding prophage found in Serratia entomophila, an insect pathogen . This prophage might represent a missing protein secretion apparatus in A. asiaticus .

Host Cell Interaction Mechanisms

A. asiaticus employs several mechanisms to interact with its host cells. It encodes a variety of proteins predicted to be important for this interaction, including a remarkable number of proteins with eukaryotic domains such as ankyrin-, TPR/SEL1-, and leucine-rich repeats . Furthermore, A. asiaticus encodes 26 proteins that can interfere with the host ubiquitin system, including F- and U-box domain proteins and two ubiquitin-specific proteases of the CA clan C19 family .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; Aasi_1337; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Amoebophilus asiaticus (strain 5a2)
Target Names
Aasi_1337
Target Protein Sequence
MTYLYDNSTLWIPILLGFLLFLYFFPVNLWITALFSGVRVSLFELVFMRIRRVPPRVIVE SMITATKAGLQVTTTEIETHYLAGGNVPSVIRALISADKANIKLTFKQATAIDLAGRDVF QAVQISVNPKVINTPSVAAVAADGIQLVTKARVTVRANIQQLVGGAGEDTILARVGEGIV TSIGSAASHKEVLANPDQISKLVLQRGLDAGTAFEILSIDIADVDVGENIGAKLQIDQAN ADLRVAEAKAEERRAMAVAVEQEMRAKSQEARAQVILAESEIPKAMSAALKSGHIGVMDY YRMQNIKADTNMRAAISGEGEPNTETEGNPNIQ
Uniprot No.

Target Background

Function
Amoebophilus asiaticus UPF0365 protein Aasi_1337 (Aasi_1337) is found within functional membrane microdomains (FMMs), potentially analogous to eukaryotic membrane rafts. These FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are implicated as key regulators of membrane fluidity.
Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Membrane raft; Single-pass membrane protein.

Q&A

Why is Amoebophilus asiaticus being studied by researchers?

Amoebophilus asiaticus has garnered significant research interest because:

  • It is an obligate intracellular symbiont of amoebae, providing insights into host-microbe adaptation

  • Its genome encodes an extraordinary number of proteins with eukaryotic domains, including ankyrin-, TPR/SEL1-, and leucine-rich repeats, which is unprecedented among prokaryotes

  • It contains 26 proteins that can interfere with the host ubiquitin system, including unique prokaryotic members of the CA clan C19 family of ubiquitin-specific proteases

  • Studying amoeba symbionts provides understanding of how bacterial pathogens adapt to eukaryotic hosts, as amoebae serve as "training grounds" for many bacterial pathogens of humans

What expression systems are commonly used for producing Aasi_1337 recombinant protein?

The most common expression system for Aasi_1337 is Escherichia coli, with the protein typically expressed with an N-terminal His tag to facilitate purification . E. coli is preferred because:

  • It offers rapid, cost-effective protein production

  • Expression can yield up to 50% of total cellular protein

  • It has well-established protocols for induction and purification

  • The system is robust and scalable for research quantities

How can I optimize the expression of Aasi_1337 in E. coli to improve protein solubility?

Optimization of Aasi_1337 expression requires careful consideration of several factors:

Optimization ParameterRecommended ApproachRationale
Translation initiationOptimize accessibility of translation initiation sitesmRNA accessibility is the single best predictor of protein expression success
Expression temperatureLower to 18-25°CSlows protein synthesis, allowing proper folding
Induction conditionsUse lower IPTG concentration (0.1-0.5 mM)Prevents overwhelming the folding machinery
Co-expressionAdd molecular chaperones (GroEL/ES, DnaK)Assists proper protein folding
Host strainTry BL21(DE3), Rosetta, or Origami strainsDifferent strains optimize different aspects of expression
Codon optimizationFocus on first 9 codonsEarly codons strongly influence translation efficiency

Recent research analyzing 11,430 recombinant protein production experiments revealed that the accessibility of translation initiation sites (modeled using mRNA base-unpairing across the Boltzmann's ensemble) significantly outperforms other features in predicting expression success. Tools like TIsigner can help optimize the first nine codons of the mRNA with synonymous substitutions to enhance expression .

What purification strategies yield the highest purity for Aasi_1337?

For His-tagged Aasi_1337 protein, a multi-step purification strategy is recommended:

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC)

    • Use Ni-NTA or Co2+ resin with imidazole gradient elution

    • Buffer conditions: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole

  • Intermediate Purification: Ion Exchange Chromatography

    • Based on the theoretical pI of Aasi_1337

    • Removes contaminants with different charge properties

  • Polishing Step: Size Exclusion Chromatography

    • Separates any aggregates or oligomeric forms

    • Buffer optimization for final application (typically Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

Expected purity should be greater than 90% as determined by SDS-PAGE .

What are the recommended storage conditions for preserving Aasi_1337 activity?

For optimal stability and activity preservation:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution in deionized sterile water (0.1-1.0 mg/mL), add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be stored at 4°C for up to one week

  • For reconstituted protein without glycerol, store at -20°C and use within 1 month

Repeated freezing and thawing significantly reduces protein activity and should be avoided .

How does Aasi_1337 potentially function in host-symbiont interactions?

As a protein from Amoebophilus asiaticus, Aasi_1337 likely contributes to the complex relationship between this obligate intracellular bacterium and its amoeba host:

  • Membrane Organization: As a flotillin-like protein, Aasi_1337 may participate in organizing membrane microdomains within the bacterial cell or at the host-symbiont interface

  • Signaling Pathways: It potentially mediates signaling between the symbiont and host

  • Host Adaptation: Aasi_1337 may be part of the extensive arsenal of proteins that A. asiaticus uses to adapt to the intracellular environment of amoebae

The genome of A. asiaticus encodes an unprecedented number of proteins with eukaryotic domains that are likely important for host cell interaction . While the specific function of Aasi_1337 requires further investigation, its conservation in this symbiont suggests importance in the bacteria's lifecycle within amoebae.

What experimental approaches can determine the subcellular localization of Aasi_1337 in host cells?

To investigate Aasi_1337 localization within host cells, consider these methodological approaches:

TechniqueMethodologyAdvantagesLimitations
Immunofluorescence microscopyExpress recombinant Aasi_1337 in host cells, fix, and stain with anti-His antibodiesProvides spatial resolution and co-localization with host markersRequires specific antibodies and fixation may alter native localization
Live-cell imagingExpress Aasi_1337 fused to fluorescent proteins (GFP, mCherry)Allows real-time monitoring of protein dynamicsFusion may affect protein localization or function
Subcellular fractionationSeparate cellular compartments by differential centrifugation and detect protein by Western blotBiochemical verification of localizationLimited spatial resolution, potential cross-contamination
Electron microscopy with immunogold labelingUltrathin sections labeled with gold-conjugated antibodiesNanometer-scale resolutionComplex sample preparation, limited to fixed samples
Proximity labeling (BioID or APEX2)Fuse Aasi_1337 to a proximity labeling enzyme to identify neighboring proteinsIdentifies protein interaction networks in specific compartmentsRequires genetic modification, potential artifacts

For flotillin-like proteins such as Aasi_1337, detergent-resistant membrane fractionation can also help determine association with lipid rafts or specialized membrane domains.

What is known about the potential role of Aasi_1337 in manipulating host ubiquitin systems?

While the specific role of Aasi_1337 in ubiquitin system manipulation is not directly established in the provided search results, this research direction is promising based on what we know about Amoebophilus asiaticus:

  • A. asiaticus encodes an exceptional 26 proteins that can interfere with host ubiquitin systems, including F- and U-box domain proteins and the first prokaryotic ubiquitin-specific proteases of the CA clan C19 family

  • Interference with the host ubiquitin system appears to be a critical host cell interaction mechanism for A. asiaticus

  • To investigate if Aasi_1337 participates in this process, researchers could:

    • Perform pull-down assays to identify interactions with ubiquitin pathway components

    • Assess ubiquitination patterns in cells expressing Aasi_1337

    • Generate knockout/knockdown strains to observe changes in host ubiquitination

    • Use mass spectrometry to identify potential ubiquitin-related binding partners

This research avenue could reveal new mechanisms of symbiont-host interaction and potentially uncover novel strategies for manipulating cellular processes.

What are the most common challenges in expressing Aasi_1337, and how can they be addressed?

Researchers may encounter several challenges when expressing Aasi_1337:

ChallengeLikely CauseSolution Strategies
Low expression levelsPoor translation initiationOptimize accessibility of translation initiation sites using tools like TIsigner
Protein insolubilityRapid expression leading to misfoldingLower temperature (16-25°C), reduce inducer concentration, co-express chaperones
Protein degradationProtease sensitivityUse protease-deficient strains (BL21), add protease inhibitors
Toxicity to host cellsInterference with host processesUse tight expression control systems, lower inducer concentration
Poor purification yieldTag inaccessibilityTry different tag positions (N vs C-terminal) or different tags

Analysis of 11,430 recombinant protein production experiments revealed that approximately 50% of recombinant proteins fail to be expressed in various host cells . For Aasi_1337 specifically, its origin from an obligate intracellular bacterium may present unique folding requirements that are challenging to reproduce in E. coli.

How can I design experiments to investigate protein-protein interactions involving Aasi_1337?

To study Aasi_1337 interactions with host or bacterial proteins:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Fuse Aasi_1337 to a DNA-binding domain as bait

    • Screen against a prey library of host proteins

    • Verify interactions using co-immunoprecipitation

  • Pull-Down Assays:

    • Use purified His-tagged Aasi_1337 as bait

    • Incubate with host cell lysates

    • Identify interacting partners by mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein between Aasi_1337 and potential partners

    • Co-expression and reconstitution of fluorescence indicates interaction

    • Allows visualization of interaction sites within cells

  • Proximity-Dependent Labeling:

    • Fuse Aasi_1337 to BioID or APEX2

    • Identify proximal proteins through biotinylation and streptavidin purification

    • Particularly valuable for transient or weak interactions

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified Aasi_1337 on a sensor chip

    • Flow potential binding partners over the surface

    • Quantitatively measure binding kinetics and affinity

Focus particularly on proteins involved in host ubiquitin systems, as A. asiaticus is known to encode proteins that interfere with these pathways .

What controls should be included when studying the functional effects of Aasi_1337 in cellular assays?

Robust experimental design requires appropriate controls:

Control TypePurposeExample
Negative controlsEstablish baselineUntransfected cells; cells expressing unrelated protein with same tag
Positive controlsValidate assay functionalityKnown modulator of studied pathway
Expression controlsVerify protein expressionWestern blot to confirm Aasi_1337 expression levels
Localization controlsConfirm expected distributionCo-staining with compartment markers
Mutant variantsIdentify critical domains/residuesStructure-guided point mutations or truncations
Dose-dependencyEstablish causalityTitration of Aasi_1337 expression levels
Time-courseDetermine temporal dynamicsSampling at multiple timepoints post-expression
System specificityTest host-range effectsExpress in different cell types (amoebae vs. mammalian cells)

For flotillin-like proteins, include controls to distinguish effects of membrane reorganization from direct protein-protein interactions, such as membrane fluidity assays and cholesterol depletion experiments.

How does Aasi_1337 relate to other flotillin-like proteins across bacterial species?

Comparative analysis of Aasi_1337 with other flotillin-like proteins reveals evolutionary insights:

  • Flotillin-like proteins are relatively rare in bacteria compared to eukaryotes

  • Their presence in bacterial symbionts suggests potential horizontal gene transfer or convergent evolution

  • In Amoebophilus asiaticus, this protein may represent an adaptation specifically for interaction with amoeba hosts

Evolutionary analysis should examine:

  • Sequence conservation patterns across bacterial flotillin-like proteins

  • Domain architecture comparisons

  • Phylogenetic relationships between bacterial and eukaryotic flotillins

  • Presence in other amoeba-associated bacteria such as Legionella pneumophila, Rickettsia bellii, and Francisella tularensis

This comparative approach can reveal whether Aasi_1337 represents a specialized adaptation in A. asiaticus or a more broadly conserved mechanism for host interaction.

What can structural analysis reveal about Aasi_1337 function?

While no specific structural data for Aasi_1337 is provided in the search results, researchers can gain functional insights through structural approaches:

  • Homology Modeling:

    • Generate 3D structural models based on related proteins

    • Identify potential functional domains and binding sites

    • Guide mutational studies to test structure-function hypotheses

  • Secondary Structure Prediction:

    • Analyze sequence for alpha-helices, beta-sheets, and disordered regions

    • Predict membrane-associating regions typical of flotillin-like proteins

  • Domain Annotation:

    • Identify conserved domains through databases like Pfam and InterPro

    • Map eukaryotic-like domains that may mediate host interactions

  • Experimental Structure Determination:

    • X-ray crystallography of purified Aasi_1337

    • Cryo-EM analysis of larger complexes

    • NMR studies for dynamic regions

Structural insights can reveal how Aasi_1337 might function in membrane organization or protein-protein interactions within the host-symbiont interface.

How might Aasi_1337 contribute to the adaptation of bacteria to eukaryotic host environments?

As part of the Amoebophilus asiaticus genome, Aasi_1337 may play a role in the broader context of bacterial adaptation to eukaryotic hosts:

  • Amoebae serve as "training grounds" for bacterial pathogens of humans, as evidenced by the enrichment of similar eukaryotic domains across phylogenetically diverse bacteria that can infect amoebae

  • Studying Aasi_1337 may reveal conserved mechanisms used by various intracellular bacteria to:

    • Establish intracellular niches

    • Evade host defense systems

    • Manipulate host cellular processes

    • Access host nutrients

  • Research questions to explore:

    • Does Aasi_1337 have functional homologs in human pathogens?

    • Can Aasi_1337 expression in model bacteria confer enhanced ability to survive in eukaryotic cells?

    • Does Aasi_1337 target conserved eukaryotic cellular processes?

This research direction connects to the broader question of how amoeba-associated bacteria evolve mechanisms for host cell interaction that may later be repurposed for infection of higher eukaryotes including humans .

What methodological advances could improve our ability to study proteins from obligate intracellular bacteria like A. asiaticus?

Studying proteins from obligate intracellular bacteria presents unique challenges that could be addressed through methodological innovations:

  • Improved Expression Systems:

    • Development of eukaryotic cell-free systems that better mimic the natural environment

    • Co-expression with symbiont-specific chaperones

    • Cell-based expression platforms using amoeba or related host cells

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize protein distribution at nanoscale

    • Correlative light and electron microscopy (CLEM) to connect molecular localization with ultrastructural context

    • Live-cell imaging with minimal perturbation to host-symbiont interactions

  • Systems Biology Approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network analysis to place individual proteins in functional context

    • Mathematical modeling of host-symbiont interactions

  • Genetic Manipulation:

    • Development of genetic tools for obligate intracellular bacteria

    • CRISPR-Cas9 approaches adapted for symbionts

    • Conditional expression systems for essential genes

These methodological advances would not only benefit Aasi_1337 research but would broadly impact our ability to study host-microbe interactions across many biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.