Recombinant Amphidinium carterae Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Amphidinium carterae Cytochrome b6-f Complex Subunit 4 (petD)

Amphidinium carterae is a dinoflagellate known for its abundance in marine environments and its use as a model organism in studies of genetics, photosynthesis, and polyketide production . The cytochrome b6-f complex, a crucial component in oxygenic photosynthesis, mediates electron transport between Photosystem II and Photosystem I . Subunit 4, encoded by the petD gene, is an integral part of this complex.

Cytochrome b6-f Complex and the Role of petD

The cytochrome b6-f complex acts as a linker in photosynthetic electron transport . It comprises several subunits, including PetD, which contributes to the complex's stability and function .

petD in Amphidinium carterae

The chloroplast genome of dinoflagellates encodes subunits of the cytochrome b6-f complex . Research on A. carterae has contributed to understanding the structures of photosynthetic supercomplexes and how they efficiently convert light .

Genetic Diversity and Molecular Studies of Amphidinium Species

Genetic analysis has revealed diversity among Amphidinium species, including those closely related to A. carterae . Molecular studies often target regions such as LSU rDNA, ITS rDNA, and mitochondrial genes like cytochrome b .

Importance of PetM in Cytochrome b6-f Complex

PetM, while not the same as PetD, is another subunit of the cytochrome b6-f complex . Studies in Arabidopsis thaliana have shown that PetM is essential for maintaining the function of the cytochrome b6-f complex, suggesting it stabilizes the complex's core .

Mitochondrial Genome Organization in Amphidinium carterae

The mitochondrial genome of A. carterae contains genes such as cox1, cox3, and cob, encoding proteins found in the mitochondrion . The genome exhibits a complex organization with full-length genes, pseudogenes, and coding region fragments .

PSI-AcpPCI Supercomplex Structures in Amphidinium carterae

Cryo-electron microscopy has revealed the structure of the PSI-AcpPCI supercomplex in A. carterae, showing unique features in the dinoflagellate PSI core and light-harvesting antennae . The PsaA/B subunits in A. carterae PSI are smaller than those in centric diatoms, with variations in amino acid residues and chlorophyll a sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Amphidinium carterae (Dinoflagellate)
Target Names
petD
Target Protein Sequence
MVVRLPYVKGSILCSALAKGCGHNYYGEPAWPNDILYIFPVVILGTISFSLGLGVIENQA IGEPANPFATPLEILPEWYFFPTFNLLRILPDKLVGVLSLASVPVILVLTAFIENINRYQ NPFRRPVASLVYLTSTCYALWLGYGSVLGISEALPFV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Amphidinium carterae and why is it significant for studying photosynthetic processes?

Amphidinium carterae is a species of dinoflagellate first described by Edward M. Hulburt in 1957 and named after British phycologist Nellie Carter-Montford . This photosynthetic organism is widely distributed in coastal waters and has become a valuable model organism for research due to several unique characteristics. A. carterae contains peridinin (a carotenoid) in its chloroplasts and possesses an extraordinary chloroplast genome organization where genes are mounted on numerous small circular DNA elements called minicircles rather than on a single large circular chromosome as in most photosynthetic organisms . This unusual genomic architecture provides researchers with a unique system to study chloroplast genome evolution, gene expression, and photosynthetic processes.

What is the structure and function of the petD gene in Amphidinium carterae?

The petD gene in Amphidinium carterae encodes subunit IV (suIV) of the cytochrome b6/f complex, which is a crucial component of the photosynthetic electron transport chain . Unlike most chloroplast genomes where petD is part of a continuous circular chromosome, in A. carterae, this gene is located on its own minicircle (accession number DQ507217) . The petD gene in A. carterae shares high sequence identity with its homolog in the closely related species A. operculatum, with protein sequence identities exceeding 99% . Functionally, subunit IV works in concert with cytochrome b6 to form a stable complex that transfers electrons between photosystem II and photosystem I during photosynthesis, making it essential for energy conversion in this organism.

How is the minicircle structure of the Amphidinium carterae chloroplast genome organized?

The chloroplast genome of Amphidinium carterae is fragmented into approximately 20 small circular DNA molecules called minicircles, each typically 2-3 kb in size . Each minicircle contains a conserved core region and one or occasionally two protein-coding genes. The petD gene is located on its own dedicated minicircle with the accession number DQ507217 . The minicircles share a common non-coding region called the "core" which likely contains the origin of replication and promoter elements. The mean GC content of A. carterae minicircles is approximately 45.27% . This fragmented genome architecture represents an extreme case of chloroplast genome reduction and is believed to have resulted from extensive gene transfer to the nuclear genome during evolution, with only a small subset of essential genes remaining in the chloroplast.

How can the petD gene be isolated and characterized from Amphidinium carterae?

The isolation and characterization of the petD gene from Amphidinium carterae can be accomplished through a systematic molecular biology approach. First, researchers should isolate DNA enriched in minicircle sequences using modified chloroplast DNA extraction protocols. PCR amplification can then be performed using either degenerate primers based on conserved regions of petD sequences from related species (such as A. operculatum) or primers targeting the conserved core region of A. carterae minicircles . A successful approach documented in the literature involved using adjacent opposed specific primers designed according to fragment sequences to generate the full minicircle sequence .

After amplification, the complete minicircle containing petD can be sequenced using standard DNA sequencing methods. Sequence verification should include BLAST searches and CodonPreference analysis to confirm the identity of the coding region. The sequence can be annotated by identifying the open reading frame encoding the petD gene and the conserved core region. For further characterization, researchers can analyze transcription using RT-PCR and northern blotting to confirm gene expression, and the protein product can be studied using proteomics approaches such as western blotting with antibodies against subunit IV.

What are the established protocols for creating recombinant Amphidinium carterae petD constructs?

Creating recombinant constructs of the Amphidinium carterae petD gene involves several steps tailored to the unique minicircle genome structure of this organism. The process begins with designing artificial minicircles based on the native petD minicircle structure. These artificial minicircles must maintain the core region of the original minicircle while allowing for the modification or replacement of the petD gene with a recombinant version or a selectable marker .

A validated approach for transformation involves biolistics (particle bombardment) to introduce the artificial minicircle constructs into A. carterae cells . Recent research has demonstrated that artificial minicircles based on various native minicircles, including the petD minicircle, can be used for successful transformation in A. carterae . The constructs should include appropriate promoter and terminator sequences derived from the native minicircle to ensure proper expression. Selection of transformed cells typically relies on antibiotic resistance markers or other selectable phenotypes incorporated into the artificial minicircle design.

For verification of transformation success, researchers should employ PCR to detect the introduced construct, RT-PCR to confirm transcription, and western blotting or functional assays to verify protein expression. The development of these techniques has opened up possibilities for genetic manipulation studies in dinoflagellates, which were previously considered recalcitrant to genetic transformation.

What analytical techniques are most effective for studying the assembly of recombinant cytochrome b6/f complex containing petD-encoded subunit IV?

The assembly of the cytochrome b6/f complex containing the petD-encoded subunit IV can be effectively studied using a combination of biochemical, biophysical, and genetic approaches. Based on research with similar systems, the following methodologies are particularly informative:

Genetic Manipulation and Expression Analysis:

  • Creation of deletion mutants lacking specific complex components to study assembly dependencies

  • Pulse-labeling and pulse-chase experiments to monitor protein synthesis and turnover rates

  • Western blotting to assess protein accumulation levels in various genetic backgrounds

Biochemical Characterization:

  • Blue native PAGE to isolate intact complexes and assess assembly status

  • Sucrose gradient ultracentrifugation to separate and purify assembled complexes

  • Immunoprecipitation with antibodies against different subunits to study complex formation

Structural Analysis:

  • Cryo-electron microscopy to determine the structure of the assembled complex

  • Mass spectrometry to identify post-translational modifications and interaction partners

  • FRET or cross-linking studies to analyze subunit proximity and interactions

Studies on the cytochrome b6/f complex in other organisms have revealed that the stabilization of subunit IV in thylakoid membranes is dependent on the presence of cytochrome b6, suggesting a coordinated assembly process . Similar approaches applied to the A. carterae system would provide valuable insights into the assembly mechanism of this complex in dinoflagellates.

How does the petD gene in Amphidinium carterae compare to homologous genes in other photosynthetic organisms?

The petD gene in Amphidinium carterae shows both conserved features and unique characteristics when compared to homologous genes in other photosynthetic organisms. A comparative analysis reveals several important aspects:

Sequence Conservation:
Comparison between closely related dinoflagellates shows high conservation of the petD sequence. For example, the predicted amino acid sequences of petD between A. carterae and A. operculatum show greater than 99% identity, indicating strong evolutionary conservation of this essential photosynthetic component even within the unusual minicircle genomic context .

Genomic Context:
Unlike most photosynthetic organisms where petD is part of a contiguous chloroplast genome, in A. carterae, petD resides on its own minicircle (accession number DQ507217) . This represents a dramatic departure from the typical operon-like arrangement seen in most plastids.

Functional Domains:
Despite the unusual genomic context, the functional domains of the petD-encoded protein remain conserved, reflecting the essential role of this subunit in electron transport. The core structural elements necessary for interaction with cytochrome b6 and participation in the electron transport chain are preserved.

This evolutionary divergence in genomic organization while maintaining functional conservation highlights the remarkable plasticity of chloroplast genomes and provides a valuable system for studying chloroplast genome evolution.

What insights can be gained from studying regulatory mechanisms of petD expression in Amphidinium carterae?

Studying the regulatory mechanisms of petD expression in Amphidinium carterae provides unique insights into gene regulation in the unusual minicircle genome context. Unlike typical chloroplast genes that may be regulated as part of operons, the petD gene in A. carterae exists on its own minicircle, suggesting potentially distinct regulatory mechanisms.

Research on the cytochrome b6/f complex in other organisms has revealed that the accumulation of complex subunits involves multiple regulatory processes. For example, in Chlamydomonas reinhardtii, while the rates of synthesis of cytochrome b6 and subunit IV are independent of the presence of other subunits, their stabilization in thylakoid membranes is a concerted process . There is a marked dependence of subunit IV stability on the presence of cytochrome b6 . In contrast, the synthesis of cytochrome f (encoded by petA) is regulated at the co-translational or early post-translational level .

Similar regulatory mechanisms may exist in A. carterae, potentially adapted to the minicircle genome architecture. Investigation of these mechanisms would reveal how gene expression coordination is achieved in a fragmented genome system and could provide insights into the evolution of gene regulation in photosynthetic organisms. These studies might also uncover novel regulatory elements in the conserved core regions of minicircles that could function as promoters or binding sites for regulatory proteins.

How can gene editing technologies be optimized for manipulating the petD gene in Amphidinium carterae?

Optimizing gene editing technologies for the petD gene in Amphidinium carterae presents unique challenges due to the unusual minicircle chloroplast genome organization. A strategic approach would integrate recent advances in dinoflagellate transformation with modern gene editing tools:

Artificial Minicircle Design:
Building on established transformation methods, artificial minicircles based on the native petD minicircle structure should be designed with specific modifications to facilitate gene editing . These constructs must maintain the core region essential for replication and transcription while incorporating sequences for targeted modification.

Delivery Methods:
Biolistics (particle bombardment) has been successfully used for transformation of A. carterae and represents a viable method for delivering gene editing components . Optimization of particle size, acceleration pressure, and DNA coating procedures specifically for A. carterae would improve transformation efficiency.

CRISPR/Cas Systems Adaptation:
Adapting CRISPR/Cas systems for chloroplast gene editing in A. carterae would require:

  • Design of guide RNAs targeting specific sequences within the petD gene

  • Optimization of Cas protein variants that function efficiently in the chloroplast environment

  • Development of expression cassettes compatible with the minicircle architecture

Selection Strategies:
Given the high copy number of minicircles in each cell, effective selection strategies are crucial. Approaches might include:

  • Co-transformation with selectable markers on artificial minicircles

  • Development of phenotypic screens that can detect altered cytochrome b6/f complex function

  • Enrichment techniques to isolate cells with higher proportions of edited minicircles

These approaches would need to be integrated with detailed molecular verification methods to confirm successful editing of the petD gene across the population of minicircles within transformed cells.

What insights can structural studies of recombinant Amphidinium carterae cytochrome b6/f complex provide about photosynthetic electron transport?

Structural studies of the recombinant Amphidinium carterae cytochrome b6/f complex could provide valuable insights into photosynthetic electron transport in dinoflagellates and eukaryotic photosynthesis more broadly. Several key aspects could be investigated:

Unique Structural Adaptations:
Determining whether the A. carterae complex has unique structural features compared to those from other photosynthetic organisms could reveal adaptations specific to dinoflagellate physiology. These might include modifications that optimize function in marine environments or under the specific light conditions experienced by these organisms.

Subunit Interactions:
Detailed analysis of how subunit IV (encoded by petD) interacts with cytochrome b6 and other components of the complex would enhance our understanding of complex assembly and stability. Studies in Chlamydomonas reinhardtii have shown that stabilization of subunit IV in thylakoid membranes has a marked dependence on the presence of cytochrome b6 . Similar interdependencies in A. carterae could reveal conserved assembly mechanisms.

Electron Transfer Pathways:
Structural characterization could elucidate the precise arrangement of electron carriers within the complex, providing insights into the efficiency and regulation of electron transfer in dinoflagellate photosynthesis.

Lipid-Protein Interactions:
Analysis of lipid binding sites and membrane integration features could reveal how the complex is optimized for function within the unique thylakoid membrane composition of dinoflagellates.

These structural studies would benefit from integrating multiple approaches, including cryo-electron microscopy, X-ray crystallography, and computational modeling, to build comprehensive models of the complex architecture and dynamic function.

What potential biotechnological applications exist for engineered variants of Amphidinium carterae petD?

Engineered variants of the Amphidinium carterae petD gene and its encoded subunit IV offer several promising biotechnological applications, leveraging the unique properties of dinoflagellate photosynthesis and genetic systems:

Enhanced Photosynthetic Efficiency:
Strategic modifications to the petD gene could potentially optimize electron transport through the cytochrome b6/f complex, enhancing photosynthetic efficiency and biomass production. This would be valuable for biofuel production and carbon sequestration applications using A. carterae.

Biosensors for Environmental Monitoring:
Engineered variants of the petD gene coupled with reporter systems could be developed into biosensors for monitoring environmental conditions such as light quality, pollutants that affect photosynthesis, or specific ions that interact with the cytochrome b6/f complex.

Protein Expression Platform:
The minicircle-based transformation system incorporating modified petD minicircles could be developed into a platform for expressing recombinant proteins in the chloroplast of A. carterae . This could be particularly valuable for producing proteins that benefit from the folding environment of the chloroplast or that function in photosynthesis-related processes.

Study System for Synthetic Biology:
The unusual minicircle genome architecture provides a unique system for developing and testing synthetic biology approaches. Engineered petD minicircles could serve as models for designing artificial gene circuits that operate within the chloroplast, potentially leading to new insights in synthetic genomics.

Photosynthetic Hydrogen Production:
Modifications to the electron transport chain, including engineered variants of petD, could potentially redirect electron flow toward hydrogenase enzymes, enhancing biohydrogen production capabilities in engineered A. carterae strains.

These applications would require further development of genetic tools for A. carterae, including precise gene editing capabilities and improved transformation efficiencies .

What strategies can address low expression levels of recombinant petD in Amphidinium carterae?

Low expression levels of recombinant petD in Amphidinium carterae can be addressed through multiple strategic approaches that consider the unique aspects of dinoflagellate genetics and physiology:

Optimization of Artificial Minicircles:

  • Ensure the core region of the native petD minicircle is completely preserved in artificial constructs

  • Include all necessary promoter elements and untranslated regions from the native gene

  • Test multiple artificial minicircle designs with varying arrangements of regulatory elements

Codon Optimization:

  • Analyze the codon usage patterns in highly expressed A. carterae chloroplast genes

  • Adapt the recombinant petD sequence to match preferred codon usage while maintaining functional domains

  • Consider the GC content (approximately 45.27% for native minicircles) when designing synthetic genes

Culture Condition Optimization:

  • Test expression under different light conditions, as photosynthetic gene expression often responds to light quality and intensity

  • Optimize temperature and nutrient availability based on the native habitat conditions of A. carterae

  • Consider temporal factors, as expression may vary throughout the day due to circadian regulation

Selection and Enrichment Strategies:

  • Develop methods to select for cells with higher copy numbers of the recombinant minicircle

  • Use antibiotic selection pressure for extended periods to enrich populations with stable integration

  • Implement cell sorting techniques to isolate high-expressing subpopulations

Stabilization Approaches:

  • Co-express interacting partners such as cytochrome b6, as studies in other organisms show that subunit IV stability depends on its presence

  • Modify potential protease recognition sites to reduce degradation while maintaining functionality

  • Explore fusion with stabilizing protein domains that don't interfere with complex assembly

Implementation of these strategies should be accompanied by quantitative measurements of expression levels using RT-qPCR, western blotting, and functional assays to determine which approaches most effectively enhance recombinant petD expression.

How can the assembly of recombinant cytochrome b6/f complex be verified in Amphidinium carterae?

Verifying the successful assembly of recombinant cytochrome b6/f complex containing modified petD-encoded subunit IV in Amphidinium carterae requires a multi-faceted approach combining biochemical, spectroscopic, and functional analyses:

Biochemical Verification:

  • Blue Native PAGE to isolate intact complexes and verify their molecular weight

  • Immunoprecipitation with antibodies against different subunits followed by western blotting to confirm co-precipitation of all components

  • Sucrose gradient ultracentrifugation to purify assembled complexes and verify their composition by mass spectrometry

  • Size exclusion chromatography to assess complex integrity and homogeneity

Spectroscopic Analysis:

  • Absorption spectroscopy to detect characteristic spectral features of properly assembled cytochrome components

  • Fluorescence measurements to assess energy transfer within the complex

  • Circular dichroism to evaluate secondary structure formation indicative of proper folding

Functional Assays:

In vivo Localization:

  • Confocal microscopy with fluorescently labeled antibodies to confirm proper localization to thylakoid membranes

  • Electron microscopy with immunogold labeling to visualize the distribution of the complex within chloroplast membranes

By combining these approaches, researchers can comprehensively verify not only the presence of the recombinant complex but also its proper assembly, structural integrity, and functional capacity within the photosynthetic apparatus of A. carterae.

What analytical challenges are associated with characterizing the interaction between recombinant petD-encoded subunit IV and other components of the cytochrome b6/f complex?

Characterizing interactions between recombinant petD-encoded subunit IV and other components of the cytochrome b6/f complex in Amphidinium carterae presents several analytical challenges that stem from both the properties of membrane proteins and the unique aspects of dinoflagellate biology:

Membrane Protein Solubilization:

  • Finding detergents that effectively solubilize the complex while maintaining native protein-protein interactions

  • Determining optimal conditions that prevent aggregation without causing dissociation of the complex

  • Developing methods to reconstitute the complex into artificial membrane systems that mimic the native environment

Stoichiometry Determination:

  • Accurately quantifying the incorporation rate of recombinant subunit IV versus native versions

  • Developing methods to distinguish between fully assembled complexes and partial assemblies

  • Accounting for potential heterogeneity in complex composition across the population of transformed cells

Dynamic Interactions:

  • Capturing transient interactions that may occur during the assembly process

  • Distinguishing between specific interactions relevant to function and non-specific associations

  • Measuring binding affinities and kinetics in the context of membrane environments

Technical Limitations:

  • Working with the relatively low abundance of the complex in comparison to other cellular components

  • Developing specific antibodies or tags that do not interfere with complex assembly

  • Adapting standard interaction analysis techniques to work with the unique properties of dinoflagellate proteins

Data Interpretation Complexities:

  • Differentiating between direct and indirect interactions within the multi-subunit complex

  • Relating structural information to functional outcomes in electron transport

  • Accounting for potential effects of post-translational modifications on interaction profiles

Addressing these challenges requires an integrated approach combining multiple complementary techniques such as cross-linking mass spectrometry, FRET analysis, surface plasmon resonance adapted for membrane proteins, and hydrogen-deuterium exchange mass spectrometry. Additionally, computational modeling based on homologous structures from other organisms can provide valuable frameworks for interpreting experimental data on subunit interactions.

What are the most promising future research directions involving recombinant Amphidinium carterae petD?

The study of recombinant Amphidinium carterae petD presents several promising research directions that could significantly advance our understanding of photosynthesis and dinoflagellate biology while offering practical biotechnological applications:

Advanced Genome Engineering:
Further development of CRISPR-based techniques specifically adapted for the minicircle chloroplast genome of dinoflagellates would enable precise manipulation of the petD gene and other photosynthetic components . This could facilitate structure-function studies and the creation of variants with enhanced properties.

Environmental Adaptation Studies:
Creating petD variants and testing them under different environmental conditions could reveal how the cytochrome b6/f complex is adapted to specific ecological niches, potentially explaining dinoflagellate distribution patterns and bloom formation tendencies.

Synthetic Biology Applications:
Development of artificial minicircle systems based on the petD minicircle architecture could provide novel platforms for synthetic biology applications in photosynthetic organisms, including the expression of designer electron transport chains .

Evolutionary Biology Insights:
Comparative studies of engineered petD variants in A. carterae and other dinoflagellates could provide insights into the evolutionary history of these unusual chloroplast genomes and the processes that led to the extreme genome reduction and fragmentation observed in these organisms.

These research directions would benefit from continued improvement of transformation methodologies for dinoflagellates, development of more sophisticated genetic tools, and integration of advanced imaging and analytical techniques to characterize the resulting recombinant proteins and complexes.

How might advances in recombinant petD research contribute to our broader understanding of photosynthesis?

Advances in recombinant petD research in Amphidinium carterae have the potential to make significant contributions to our broader understanding of photosynthesis through several innovative research avenues:

Evolutionary Insights:
The unusual minicircle genome organization in dinoflagellates represents an extreme case of chloroplast genome reduction and fragmentation. Understanding how the petD gene functions in this context can provide insights into the minimal genetic requirements for photosynthesis and the evolutionary forces driving chloroplast genome diversity across photosynthetic organisms .

Structural and Functional Adaptations:
Comparing the structure and function of the cytochrome b6/f complex in A. carterae with those from organisms with conventional chloroplast genomes could reveal adaptations that maintain efficient electron transport despite the unusual genomic context. This may uncover fundamental principles about structure-function relationships in photosynthetic complexes.

Regulatory Mechanisms:
Investigating how gene expression and protein assembly are coordinated when key components like petD are located on separate minicircles could reveal novel regulatory mechanisms in photosynthetic systems. Studies in other organisms have shown complex regulation of cytochrome b6/f assembly, including the dependence of subunit IV stability on the presence of cytochrome b6 . Similar mechanisms operating in the unique genomic context of dinoflagellates could provide new insights into photosynthetic protein complex assembly.

Environmental Adaptation:
Dinoflagellates thrive in diverse marine environments, suggesting that their photosynthetic apparatus, including the cytochrome b6/f complex, has adaptations for various light conditions and nutrient availabilities. Recombinant petD studies could help identify how the cytochrome b6/f complex contributes to this environmental flexibility.

These advances would complement our understanding of photosynthesis derived from traditional model organisms and could potentially identify novel features of photosynthetic electron transport that have evolved in this unique lineage of eukaryotic algae.

What interdisciplinary collaborations would be most beneficial for advancing recombinant Amphidinium carterae petD research?

Advancing recombinant Amphidinium carterae petD research would benefit significantly from strategic interdisciplinary collaborations that bring together diverse expertise to address the complex challenges in this field:

Molecular Biology and Synthetic Biology:
Collaboration with synthetic biologists specializing in minimal genomes and artificial chromosome design would facilitate the development of more sophisticated artificial minicircle systems based on the petD minicircle . This could enhance transformation efficiency and enable more complex genetic manipulations.

Structural Biology and Biophysics:
Partnerships with structural biologists proficient in membrane protein crystallography and cryo-electron microscopy would enable detailed structural characterization of the recombinant cytochrome b6/f complex. Biophysicists could contribute expertise in measuring electron transfer kinetics and assessing the functional impacts of genetic modifications.

Marine Ecology and Oceanography:
Working with marine ecologists and oceanographers would provide valuable context on the environmental conditions relevant to A. carterae in natural settings. This could inform experimental design for testing the performance of recombinant variants under ecologically relevant conditions.

Biotechnology and Bioengineering:
Partnerships with biotechnologists experienced in algal cultivation and bioprocess engineering would facilitate scaling up production of recombinant strains and exploring practical applications such as biofuel production or bioactive compound synthesis.

Evolutionary Biology: Collaboration with evolutionary biologists would strengthen comparative analyses between A. carterae and other photosynthetic organisms, providing insights into the evolutionary history of the unusual minicircle genome organization and its functional implications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.