Recombinant Amphidinium operculatum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Amphidinium operculatum Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex found in the dinoflagellate Amphidinium operculatum . The cytochrome b6-f complex is essential for photosynthetic electron transfer between Photosystem II and Photosystem I in the thylakoid membranes of chloroplasts .

Amphidinium operculatum is a dinoflagellate, a type of single-celled algae known for its unique chloroplast genome organization . Unlike most organisms where chloroplast genes are located on a single large chromosome, dinoflagellates like A. operculatum have these genes on small, circular DNA molecules called minicircles .

Genomic Organization

In Amphidinium operculatum, the petD gene, which encodes subunit 4 of the cytochrome b6-f complex, is located on a minicircle . Chloroplast genes in dinoflagellates are organized in an unusual manner, particularly among peridinin-containing taxa . Several genes, including petD, psaA, psbA, psbB, and atpB, are found on these minicircles, which have conserved core regions . The copy number of these chloroplast gene minicircles can change significantly depending on the growth phase of the dinoflagellate .

Function of Cytochrome b6-f Complex Subunit 4 (petD)

The cytochrome b6-f complex, of which petD is a subunit, plays a crucial role in photosynthesis . It mediates the transfer of electrons from Photosystem II to Photosystem I, contributing to the generation of a proton gradient across the thylakoid membrane that drives ATP synthesis .

Unique Features of Dinoflagellate Chloroplasts

Dinoflagellates exhibit a distinct chloroplast genome organization, with genes divided among numerous minicircles . These minicircles typically contain a single gene along with a conserved core region, which is thought to contain transcription initiation signals and may be involved in replication and membrane attachment .

Research Findings and Significance

  • Minicircle Structure: The core regions of minicircles vary among different minicircles but are identical for minicircles with the same genes within the same strain. These regions may function in transcription initiation, replication, and chloroplast division .

  • Gene Clusters: Some minicircles contain multiple genes. For example, psbD, psbE, and psbI genes are found together on one circle in A. carterae .

  • Aberrant Minicircles: Besides conventional minicircles, some aberrant minicircles have been reported, adding to the complexity of dinoflagellate chloroplast genomes .

Tables

Photosystem IPhotosystem IICytochrome b complex 6fATP synthaseRibosomal protein large subunitRibosomal protein small subunitRNA polymeraseHypothetical proteinRubisco
psaApsbApetBatpArpl2rps2rpoAycf4rbcL
psaBpsbBpetDatpBrpl14rps3rpoB
psaCpsbCpetGatpErpl16rps4rpoC1
psaJpsbDatpFrpl20rps7rpoC2
psbEatpHrpl36rps8
psbFrps11
psbHrps12
psbIrps14
psbJrps18
psbKrps19
psbL
psbN
psbT
psbZ

Those retained on minicircles in dinoflagellates are shown underlined .

Eubacterial sequenceAmphidinium carterae sequence
Domain IAbsent
Domain IIReduced
Domain IIIAbsent
Domain IVLargely retained
Domain VLargely retained
Domain VILargely absent, sarcin/ricin loop retained

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Amphidinium operculatum (Dinoflagellate)
Target Names
petD
Target Protein Sequence
MVVRLPYVKGSILCSALAKGCGHNYYGEPAWPNDILYIFPVVILGTISFSLGLGVIENQA IGEPANPFATPLEILPEWYFFPTFNLLRILPDKLVGVLSLASVPVILVLTAFIENINRYQ NPFRRPVASLVYLTSTCYALWLGYGSVLGISEALPFV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what function does subunit 4 (petD) serve in photosynthetic organisms?

The cytochrome b6-f complex is a crucial membrane protein complex in the photosynthetic electron transport chain. It mediates electron transfer between photosystems II and I while simultaneously creating a proton gradient across the thylakoid membrane for ATP synthesis.

Subunit IV (encoded by the petD gene) is a key structural component of the cytochrome b6-f complex. It contains three transmembrane helices (labeled E-F) that form a p-side saddle around the four-helix bundle of cytochrome b6 . This structural arrangement is essential for maintaining the complex's stability and proper function in electron transfer reactions. Studies on the cytochrome b6-f complex indicate that subunit IV, together with cytochrome b6, forms the central core domain of the complex .

In dinoflagellates like Amphidinium operculatum, the petD gene is unusually located on small DNA minicircles in the plastid genome, whereas in most photosynthetic organisms, it resides in the conventional chloroplast genome .

How is the petD gene organized in Amphidinium operculatum compared to conventional chloroplast genomes?

In A. operculatum, the petD gene is located on a single-gene minicircle of approximately 2.3-2.4 kb in size . These minicircles contain a characteristic "core" region that is highly conserved across all coding minicircles, along with gene-specific coding regions . In some cases, the petD gene can be colocalized with other genes on the same minicircle; for instance, research has shown that in A. operculatum, the petB and atpA genes can be located on the same minicircle .

These minicircular gene arrangements represent a unique evolutionary adaptation in dinoflagellates, marking a significant departure from conventional chloroplast genome organization.

What transcriptional and translational features are unique to the petD gene in Amphidinium operculatum?

Amphidinium operculatum exhibits several unique features in petD gene expression:

  • Transcription patterns: Despite petB and atpA genes being encoded in close proximity on the same minicircle, Northern analysis of total RNA from A. operculatum showed these genes are represented on separate transcripts . This suggests a complex transcriptional regulation mechanism.

  • Unusual codon usage: There are marked biases in codon preference in A. operculatum plastid genes including petD .

  • Non-canonical initiation codons: While petD may use conventional initiation codons, other genes in A. operculatum like psaA and psbB lack conventional initiation codons and may use GUA for translation initiation. RT-PCR investigations showed no evidence of editing in some transcripts, confirming that GUA can be used as an initiation codon in this organism .

  • Minicircle architecture: The non-coding regions of minicircles containing petD have a core region with highly conserved stretches across all minicircles and modular regions conserved within subsets of minicircles .

These unique features reflect the extensive genomic remodeling that has occurred during dinoflagellate evolution, particularly in their chloroplast genomes.

How has the petD gene evolved in dinoflagellates compared to other photosynthetic organisms?

The evolution of the petD gene in dinoflagellates represents a fascinating case of genome remodeling driven by endosymbiotic events:

  • Gene transfer and genome reduction: Many genes typically found in the chloroplast genome have been transferred to the nucleus in dinoflagellates, resulting in a highly reduced plastid genome. The remaining genes, including petD, are found on minicircles .

  • Conservation between closely related species: Comparative analysis between Amphidinium operculatum and Amphidinium carterae shows high sequence conservation of the petD gene, with 100% identity at the predicted amino acid level . This suggests strong selective pressure to maintain the function of this essential protein.

  • Divergence from other lineages: When compared to other photosynthetic lineages like haptophytes, red algae, and glaucophytes, the petD sequences in dinoflagellates show significant divergence. For example, in a study comparing protein sequences between species, PetD from A. operculatum was found to be absent from Heterocapsa triquetra (another dinoflagellate), highlighting the diversity even within dinoflagellates .

  • Tertiary endosymbiosis impact: Studies on fucoxanthin dinoflagellates (which underwent tertiary endosymbiosis) show that this process has dramatically remodeled their genomes. In Karenia brevis, many genes that were transferred to the nucleus in peridinin-containing dinoflagellates have been replaced by genes of haptophyte origin .

This evolutionary trajectory reflects the remarkable ability of dinoflagellates to remodel their genomes through endosymbiosis and the considerable impact of this process on their genetic architecture.

What structural and functional domains have been identified in the petD protein of Amphidinium operculatum?

The petD protein (subunit IV) of the cytochrome b6-f complex in Amphidinium operculatum contains several important structural and functional domains:

  • Transmembrane helices: The protein contains three transmembrane helices (labeled E-F) that form a p-side saddle around the four-helix bundle of cytochrome b6 .

  • Stromal region: Research has identified a stromal region of subunit IV that appears to be involved in signal transduction. Studies in other organisms have shown that specific residues in this region, particularly positions Asn122, Tyr124, and Arg125, can influence electron transfer rates when mutated .

  • Assembly interface: The petD protein interacts with cytochrome b6 to form a core sub-complex that initiates the assembly of the entire cytochrome b6-f complex . This assembly process is sequential and begins with the formation of this core structure.

  • Quinone binding site: Although not explicitly documented for A. operculatum, subunit IV typically contributes to the formation of the quinone oxidation (Qo) site, which is crucial for electron transfer between hemes bL and bH .

Understanding these structural features is essential for studying the function of the recombinant petD protein and its role in the assembly and activity of the cytochrome b6-f complex.

What is known about the sequence homology of petD across different dinoflagellate species?

Sequence homology studies of petD across dinoflagellate species reveal patterns of conservation and divergence:

Species ComparisonPetD Protein Identity Percentage
A. operculatum vs. A. carterae100.0%
A. operculatum vs. H. triquetraNot available (na)

As shown in the table, the PetD sequence is 100% identical between the closely related species A. operculatum and A. carterae . This extraordinarily high conservation suggests strong selective pressure to maintain the structure and function of this protein.

In contrast, researchers were unable to identify a homologous petD gene in Heterocapsa triquetra, indicating significant genomic divergence between different dinoflagellate lineages . This highlights the considerable genomic plasticity within dinoflagellates.

For context, other proteins in the cytochrome b6-f complex show varying degrees of conservation:

  • PetB (cytochrome b6): 99.1% identity between A. operculatum and A. carterae, 75.3% with H. triquetra

  • PsaA: 99.3% identity between A. operculatum and A. carterae, 50.7% with H. triquetra

  • PsbA: 99.7% identity between A. operculatum and A. carterae, 86.1% with H. triquetra

This pattern suggests that different components of the photosynthetic apparatus have experienced different evolutionary pressures across dinoflagellate lineages.

What PCR strategies are effective for amplifying the petD gene from Amphidinium operculatum?

Successful PCR amplification of the petD gene from Amphidinium operculatum requires specific strategies due to the unique organization of dinoflagellate plastid genomes:

  • Primer design approaches:

    • Design primers based on the conserved core region found in all minicircles

    • Use primers specific to the petD gene sequence from closely related species (e.g., A. carterae)

    • Employ degenerate primers based on conserved regions of the petD gene across species

  • Effective protocol:

    • Extract total genomic DNA using methods like the DNeasy Plant Mini Kit (Qiagen)

    • For A. operculatum, researchers have successfully used primers designed based on the core region of minicircles (UF and UR primers)

    • PCR conditions: Follow standard protocols with appropriate optimization for GC content and annealing temperatures

  • Full sequence amplification:

    • To obtain the complete minicircle sequence, use adjacent opposed specific primers designed based on initial fragment sequences

    • This approach was successful in amplifying the full minicircle containing petD gene in both A. carterae and A. operculatum

For example, in a study by Barbrook et al., researchers used primers based on the A. operculatum core region and successfully amplified petD-containing minicircles . Similarly, for other genes like psbC, degenerate primers were designed (e.g., psbC60F: TGC YTG GTG GWC WGG TAA TGC; psbC100F: GGT AAR TTM YTM GGT GCT CAT), which could be adapted for petD amplification .

This approach allows for the complete characterization of the petD gene and its surrounding sequence context, providing insights into its organization and potential regulatory elements.

What are the optimal expression systems for recombinant production of the petD protein?

The optimal expression of recombinant petD protein from Amphidinium operculatum requires careful consideration of expression systems:

  • E. coli-based pET expression system:

    • The pET expression system has been successfully used for petD protein expression

    • Commercial recombinant A. operculatum petD protein (CSB-EP881977AFAX1-B) is produced in E. coli

    • Key considerations for the pET system:

      • Use BL21(DE3) E. coli strains for optimal expression

      • IPTG induction is typically used to initiate expression

      • Codon optimization may be necessary given the unusual codon usage in dinoflagellates

  • Optimization strategies for pET system:

    • Recent improvements to pET plasmids have shown increased protein production:

      • Modified T7lac promoters can enhance transcription efficiency

      • Optimized translation initiation regions (TIRs) can significantly improve protein yields (from 0.8 mg/ml to 97 mg/ml in some cases)

      • Consider implementing these improved designs via PCR protocols described in recent literature

  • Purification approaches:

    • Expression with affinity tags (His-tag) facilitates purification

    • Recommended protein reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Storage considerations:

    • Shelf life of liquid form is approximately 6 months at -20°C/-80°C

    • Lyophilized form can be stable for up to 12 months at -20°C/-80°C

    • Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

These considerations address the challenges of expressing a chloroplast protein from a dinoflagellate in a prokaryotic host while maximizing yield and maintaining protein functionality.

How can researchers verify the proper folding and function of recombinantly expressed petD protein?

Verifying proper folding and function of recombinantly expressed petD protein requires multiple analytical approaches:

  • Structural assessment:

    • SDS-PAGE analysis to verify protein size (approximately 17 kDa for petD)

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Limited proteolysis to evaluate structural integrity

    • Size exclusion chromatography to determine oligomeric state

  • Functional assays:

    • Electron transfer measurements using electrochromic shift of carotenoids (absorbance increase at 520 nm)

    • Comparison of electron transfer rates between wild-type and recombinant protein

    • Interaction studies with other components of the cytochrome b6-f complex, particularly cytochrome b6

  • Assembly capability assessment:

    • Co-expression with cytochrome b6 to evaluate core sub-complex formation

    • In vitro reconstitution experiments with other subunits of the complex

    • Measuring stability of complexes formed with recombinant protein

  • Specific considerations for dinoflagellate proteins:

    • Evaluate correct folding in the absence of post-translational modifications that might occur in the native system

    • Consider that heterologous expression may not reproduce all features of the native protein

    • Use proteins from closely related species (e.g., A. carterae) as positive controls given their 100% sequence identity

When analyzing electron transfer function, researchers should follow approaches similar to those used in studies of cytochrome b6-f mutants, where the transmembrane electrogenic phase of electron transfer between hemes bL and bH was measured after quinol oxidation at the Qo site . Such functional assays provide direct evidence of proper folding and biological activity of the recombinant protein.

How does the petD gene contribute to the unique photosynthetic capabilities of dinoflagellates?

The petD gene and its protein product play crucial roles in the distinct photosynthetic characteristics of dinoflagellates:

  • Evolutionary adaptation:

    • The retention of petD on minicircles in the chloroplast genome (versus nuclear transfer) suggests its critical importance for photosynthetic function

    • Unlike many other plastid genes that have been transferred to the nucleus, petD remains plastid-encoded in multiple dinoflagellate species including A. operculatum, A. carterae, and Lingulodinium polyedrum

  • Electron transport chain efficiency:

    • The cytochrome b6-f complex containing subunit IV (petD product) is essential for electron transfer between photosystems

    • The unique stromal region of subunit IV is involved in signal transduction processes that regulate photosynthetic efficiency

    • These regulatory mechanisms may contribute to dinoflagellates' ability to thrive in diverse marine environments

  • State transitions and photoacclimation:

    • The cytochrome b6-f complex containing petD is involved in state transitions, which regulate the relative absorption of light energy by photosystems I and II

    • This function is particularly important for dinoflagellates, which experience varying light conditions in marine environments

    • Studies in Chlamydomonas reinhardtii have shown that the cytochrome b6-f complex interacts with the Stt7 kinase to regulate state transitions

  • Adaptation to environmental stress:

    • The unique sequence characteristics of dinoflagellate petD may contribute to the stability and function of the cytochrome b6-f complex under varying environmental conditions

    • These adaptations could be particularly relevant given that some dinoflagellates like A. operculatum produce toxins and have specific ecological niches

Understanding these aspects of petD function can provide insights into the ecological success of dinoflagellates and their ability to adapt to diverse marine environments.

What are the challenges in studying protein-protein interactions involving petD in the context of the complete cytochrome b6-f complex?

Studying protein-protein interactions involving petD in the context of the complete cytochrome b6-f complex presents several significant challenges:

  • Complex assembly dynamics:

    • The cytochrome b6-f complex is a multi-subunit membrane protein complex with a specific assembly sequence

    • The petD protein (subunit IV) forms a core sub-complex with cytochrome b6 that initiates assembly

    • Reconstructing this assembly process in vitro or in heterologous systems is challenging due to the need for proper membrane integration and interaction with other subunits

  • Membrane protein nature:

    • As a membrane protein, petD is difficult to study using conventional protein-protein interaction techniques

    • Isolating and maintaining the protein in a native-like environment requires specialized detergents or lipid systems

    • The hydrophobic nature of transmembrane regions complicates expression, purification, and structural analysis

  • Dinoflagellate-specific challenges:

    • The unusual codon usage and potential non-canonical translation initiation in dinoflagellates complicate heterologous expression

    • The unique structural features of dinoflagellate petD may affect its interactions with other proteins

    • The potential absence of specific post-translational modifications in recombinant systems may alter interaction properties

  • Methodological approaches to overcome challenges:

    • Use of membrane mimetics (nanodiscs, liposomes) to provide a native-like environment

    • Application of proximity labeling techniques (BioID, APEX) to capture transient interactions

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Single-particle cryo-electron microscopy for structural analysis of the entire complex

  • Lessons from model systems:

    • Studies in Chlamydomonas reinhardtii have shown that specific residues in subunit IV (positions equivalent to Asn122, Tyr124, and Arg125) are involved in interactions with other proteins

    • Similar interaction sites may exist in the A. operculatum petD protein, but direct experimental verification is needed

These challenges highlight the need for integrative approaches combining biochemical, biophysical, and structural methods to fully understand petD interactions within the cytochrome b6-f complex.

How do mutations in key regions of petD affect electron transfer efficiency in the cytochrome b6-f complex?

The impact of mutations in key regions of petD on electron transfer efficiency has been studied primarily in model organisms, providing insights applicable to Amphidinium operculatum:

These structure-function relationships highlight the importance of specific protein regions in maintaining the efficient operation of the cytochrome b6-f complex and the electron transport chain in photosynthesis.

What controls should be included when studying recombinant expression of petD from Amphidinium operculatum?

When studying recombinant expression of petD from Amphidinium operculatum, the following controls should be included:

  • Expression system controls:

    • Empty vector control to establish baseline expression levels and potential background

    • Positive control with a well-expressed protein in the same system (e.g., GFP in the pET system)

    • Expression of petD from a model organism with well-characterized expression patterns

  • Construct design controls:

    • Comparison of different translation initiation regions (TIRs) to optimize expression

      • Standard TIR from the pET vector

      • Optimized TIRs that have shown improved expression in recent studies

    • Variants with and without codon optimization to address the unusual codon usage in dinoflagellates

    • Constructs with different affinity tags (N-terminal vs. C-terminal) to assess impact on folding and function

  • Protein functionality controls:

    • Wild-type petD protein (if available) as a reference for activity assays

    • Structurally similar proteins from related organisms (e.g., petD from A. carterae, which shows 100% sequence identity)

    • Known mutants with altered function as benchmarks for functional assays

  • Expression condition controls:

    • Temperature series (e.g., 18°C, 25°C, 30°C, 37°C) to optimize folding

    • Induction time course (2h, 4h, 8h, overnight) to determine optimal expression duration

    • Different induction methods (IPTG concentrations, auto-induction media)

    • Various E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta) to address potential codon bias issues

  • Negative controls for interaction studies:

    • Unrelated membrane proteins to establish specificity of interactions

    • Truncated variants of petD lacking key interaction domains

    • Subunit IV proteins from distantly related organisms to assess conservation of interaction interfaces

These controls will help establish the reliability and reproducibility of results while addressing the specific challenges associated with expressing and studying this dinoflagellate protein.

How can researchers troubleshoot common issues in recombinant petD expression and purification?

Researchers may encounter several challenges when expressing and purifying recombinant petD from Amphidinium operculatum. Here are troubleshooting strategies for common issues:

  • Low expression levels:

    • Problem: Minimal protein production despite confirmed construct integrity

    • Solutions:

      • Implement improved pET vector designs with optimized translation initiation regions

      • Try codon optimization for E. coli expression (considering A. operculatum's unusual codon usage)

      • Test different E. coli strains, particularly those designed for membrane proteins (C41/C43)

      • Lower induction temperature (18-25°C) to slow expression and improve folding

      • Use autoinduction media instead of IPTG for gentler induction

  • Protein insolubility/inclusion bodies:

    • Problem: Expressed protein forms insoluble aggregates

    • Solutions:

      • Add solubility tags (SUMO, MBP, TrxA) to the construct design

      • Include membrane-mimetic environments during extraction (detergents, lipids)

      • Use specialized extraction buffers with mild detergents (DDM, LDAO)

      • Consider refolding protocols if inclusion bodies are unavoidable

      • Explore extraction from membrane fraction rather than whole-cell lysate

  • Proteolytic degradation:

    • Problem: Protein shows degradation bands on SDS-PAGE

    • Solutions:

      • Add protease inhibitors during all purification steps

      • Reduce purification time and keep samples cold

      • Test different buffer compositions for stabilization

      • Use E. coli strains lacking specific proteases (BL21 derivatives)

      • Consider the observation from mutant studies showing subunit IV has a 10-fold higher rate of protein turnover when not properly assembled

  • Poor binding to affinity resins:

    • Problem: Target protein doesn't bind effectively to purification resin

    • Solutions:

      • Move affinity tag to the opposite terminus

      • Ensure tag is accessible by adding flexible linker sequences

      • Optimize binding conditions (buffer composition, salt concentration, pH)

      • Consider using mild detergents that don't interfere with tag-resin interaction

      • Verify tag is not cleaved during expression

  • Impaired functionality:

    • Problem: Purified protein lacks expected activity

    • Solutions:

      • Ensure proper cofactor incorporation if needed

      • Test function in membrane-mimetic environments

      • Verify proper assembly with interaction partners (e.g., cytochrome b6)

      • Use samples with >85% purity as determined by SDS-PAGE

      • Reconstitute protein following recommended protocols (0.1-1.0 mg/mL in deionized water with 5-50% glycerol)

These troubleshooting approaches address the specific challenges associated with membrane proteins from dinoflagellates and can help researchers successfully express and purify functional petD protein.

What are the most effective approaches for studying petD gene regulation and expression in dinoflagellates?

Studying petD gene regulation and expression in dinoflagellates presents unique challenges due to their unusual genome organization. Here are the most effective approaches:

  • Transcriptional analysis:

    • RNA isolation and RT-PCR:

      • Use specialized RNA extraction methods optimized for dinoflagellates

      • Design primers spanning the coding region and flanking sequences

      • Employ RT-PCR to detect and quantify transcript levels under different conditions

      • For petD specifically, consider the findings that petB and atpA genes, despite being on the same minicircle, are represented on separate transcripts

    • Northern blotting:

      • Effective for determining transcript size and abundance

      • Particularly useful for detecting multiple transcript forms

      • Has been successfully used to analyze petB and atpA transcripts in A. operculatum

    • RNA-Seq:

      • Provides comprehensive analysis of the transcriptome

      • Can reveal unexpected transcript processing events

      • Allows comparison of expression levels across multiple genes

  • Polysomal analysis:

    • Study translation efficiency by isolating polysomes and associated mRNAs

    • Consider that in Lemna perpusilla mutants, translationally active mRNA for nuclear-encoded proteins can be drastically reduced while chloroplast transcripts remain present

    • This approach can reveal post-transcriptional regulation mechanisms

  • Protein analysis:

    • Immunoprecipitation of in vivo labeled proteins:

      • Can track synthesis and turnover rates

      • Has revealed differential protein turnover in some systems (e.g., subunit IV showed a 10-fold higher rate of protein turnover in a Lemna mutant)

    • Western blotting:

      • Monitor protein accumulation under different conditions

      • Use antibodies specific to petD or epitope tags in recombinant systems

  • Evolutionary and comparative approaches:

    • Comparative genomics:

      • Compare petD sequences and genomic contexts across dinoflagellate species

      • Identify conserved non-coding elements that might function in regulation

      • This approach revealed 100% amino acid identity between A. operculatum and A. carterae petD proteins

    • Phylogenetic analysis:

      • Reconstruct the evolutionary history of the petD gene

      • Identify selection pressures acting on different regions of the protein

      • This approach has revealed how tertiary endosymbiosis has driven genome evolution in dinoflagellates

  • Advanced molecular techniques:

    • PCR using primers to the conserved "core" region:

      • Effective for amplifying minicircles containing petD and related genes

      • Has revealed the existence of minicircles with no apparent coding function

    • Chromatin immunoprecipitation (ChIP):

      • Can identify proteins associated with minicircle DNA

      • Potentially useful for understanding transcriptional regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.