Recombinant Anabaena sp. Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Anabaena sp. Potassium-transporting ATPase C chain (KdpC) is a component of the Kdp-ATPase complex, which is involved in high-affinity potassium transport in bacteria . The Kdp system is crucial for maintaining potassium homeostasis, especially under potassium-limiting conditions . Anabaena species, a group of filamentous cyanobacteria, possess this system to cope with varying environmental conditions .

Kdp-ATPase System

The Kdp-ATPase system is an inducible, high-affinity potassium transport system found in various bacteria, including Anabaena and Escherichia coli . This system is essential for scavenging potassium from environments with low potassium concentrations . The Kdp-ATPase complex consists of three main subunits: KdpA, KdpB, and KdpC .

  • KdpA: A membrane protein that forms the channel through which potassium ions are transported.

  • KdpB: The ATPase subunit that provides the energy for potassium transport through ATP hydrolysis.

  • KdpC: A small hydrophobic membrane protein associated with the KdpAB complex, thought to be involved in the regulation or stabilization of the complex.

Function and Regulation

The Kdp system is regulated by environmental potassium levels . Expression of the kdpABC operon, which encodes the KdpA, KdpB, and KdpC subunits, is induced under potassium-limiting conditions and repressed when potassium is abundant . This regulation ensures that the cell only invests energy in high-affinity potassium transport when necessary . In Anabaena, the Kdp system is also subject to other regulatory mechanisms, such as those involving the two-component system Hik20-Rre19 .

Research Findings

Research has shown that the KdpB polypeptides in Anabaena torulosa are membrane-bound proteins of approximately 78 kDa, expressed strictly under potassium deficiency . These polypeptides are repressed or degraded upon the re-addition of potassium . Osmotic and ionic stresses do not significantly induce KdpB levels during extreme potassium starvation in both Anabaena and E. coli MC4100 .

Importance of Potassium Transport

Potassium is vital for numerous cellular processes, including turgor maintenance, pH regulation, enzyme activation, gene expression, and stress response regulation . In Anabaena, potassium deficiency can lead to pleiotropic effects, impairing photosynthesis and nitrogen fixation .

Differential Expression of Kdp Operons

Anabaena species may contain multiple kdpABC operons, indicating a complex regulatory mechanism . For example, Anabaena sp. PCC7120 and Anabaena sp. L-31 have two independent kdpABC operons . The differential expression of these operons allows the organism to fine-tune its response to varying potassium concentrations and environmental conditions .

Table Summarizing Key Findings

FeatureDescription
KdpB PolypeptidesTwo membrane-bound proteins of about 78 kDa in Anabaena torulosa
ExpressionStrictly under K+ deficiency; repressed or degraded upon K+ re-addition
Osmotic/Ionic StressNo significant induction of KdpB levels during extreme K+ starvation
Kdp SystemHigh-affinity K+ transport system induced under K+-limiting conditions
RegulationPrimarily regulated by K+ levels; also involves the Hik20-Rre19 two-component system
KdpC FunctionThought to be involved in the regulation or stabilization of the KdpAB complex
kdpABC OperonsMultiple operons in some Anabaena species, allowing fine-tuned response to environmental conditions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
kdpC; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Anabaena sp. (strain L31)
Target Names
kdpC
Target Protein Sequence
MSLIRELLRAIRITLIFWLITAIIYPLAILVVGQGLFPYQANGSIMQNIEAQPIGSALIG QVFASEQYFHSRPSASRYSQGRRARPTGISGGSNLAPSNPALLNRIIEEANQLREENIQP IEDLIYSSGSGLDPHISIQAASQQIERVARARNVQPDEILRLMNKYTDGRFLWIFGEPGV NVLRLNYALDLQDFNNQQNR
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural organization of kdp operons in Anabaena species?

Anabaena species possess two distinct kdp operons (kdp1 and kdp2), unlike many other bacteria which typically contain only one. The kdp1 operon (GenBank accession no. AF213466) contains five open reading frames (ORFs): kdpA1, kdpB1, kdpG1, kdpC1, and kdpD. In contrast, the kdp2 operon (GenBank accession no. AY753299) contains four ORFs: kdpA2, kdpB2, kdpG2, and kdpC2 .

A notable structural difference from Escherichia coli is the presence of an additional ORF, kdpG (encoding a hydrophobic protein), between the kdpB and kdpC genes in both operons. Unlike E. coli, Anabaena lacks the kdpF gene in both operons . This unique organization suggests distinct evolutionary adaptations in cyanobacterial potassium transport systems.

How does potassium starvation affect kdpC expression in Anabaena species?

Potassium starvation in Anabaena species triggers the expression of the entire kdp operon, including kdpC. When subjected to potassium limitation, Anabaena produces membrane-bound proteins of approximately 78 kDa that cross-react with E. coli KdpB antiserum, confirming the presence of Kdp homologs .

The expression of the Kdp-ATPase system in Anabaena is primarily regulated by environmental K+ levels, with expression occurring strictly under K+ deficiency . Unlike some other bacterial systems, the Anabaena Kdp system shows a particularly tight regulation pattern: it is neither expressed nor osmotically induced at 5 mM K+, and any pre-synthesized Kdp proteins are rapidly repressed and degraded when cells are exposed to 5 mM K+ . This distinctive regulatory pattern represents an adaptation to the cyanobacterial lifestyle.

What are the key differences between kdpC in Anabaena sp. and E. coli?

The kdpC gene in Anabaena species shows several important differences compared to its E. coli counterpart:

  • Operon structure: Anabaena possesses two distinct kdp operons (kdp1 and kdp2), while E. coli has only one .

  • Gene organization: The presence of kdpG between kdpB and kdpC in both Anabaena operons represents a unique structural feature absent in E. coli .

  • Regulatory mechanisms: While both organisms express Kdp-ATPase under potassium limitation, Anabaena shows distinct regulatory patterns, including rapid degradation of pre-synthesized Kdp proteins upon K+ addition, which is not observed to the same extent in E. coli .

  • Response to osmotic stress: Unlike E. coli, where osmotic stress can induce kdp expression (especially at moderate K+ limitation), Anabaena's kdp expression becomes insensitive to osmotic signals under extreme K+ starvation conditions .

These differences reflect the evolutionary adaptations of Anabaena to its ecological niche as a photosynthetic, nitrogen-fixing cyanobacterium.

How does the Kdp system interact with nitrogen fixation in Anabaena?

The Kdp potassium transport system plays a crucial indirect role in supporting nitrogen fixation in Anabaena. Potassium deficiency has been shown to cause pleiotropic effects in Anabaena torulosa, including impairment of photosynthesis and nitrogen fixation .

Maintaining appropriate potassium homeostasis through systems like Kdp-ATPase is essential for optimal cellular metabolism, including nitrogen fixation. In recombinant Anabaena sp. strain PCC7120 engineered for enhanced nitrogen fixation, proper functioning of ion transport systems (including potassium transport) supports the energy-intensive process of nitrogen fixation .

The connection between potassium transport and nitrogen fixation highlights the integrated nature of cellular metabolism in Anabaena and suggests potential avenues for engineering strains with improved biofertilizer capabilities.

What are the recommended methods for detecting kdpC expression in Anabaena?

Recommended detection methods include:

  • Immunological detection: Using antibodies raised against E. coli KdpB or KdpABC has proven effective in detecting cross-reactive Kdp proteins in Anabaena . Western blotting with membrane fractions is particularly useful for monitoring expression under different potassium conditions.

  • Gene expression analysis: RT-PCR or qRT-PCR targeting kdpC transcripts can quantify expression levels in response to varying potassium concentrations or other stressors.

  • Reporter gene fusions: Construction of kdpC promoter-reporter fusions (using reporters like GFP or luciferase) allows real-time monitoring of kdpC expression in living cells.

Experimental data table for immunological detection:

Potassium concentration (mM)KdpC detection methodSignal intensity (arbitrary units)Localization
0 (K+ starvation)Western blot++++Membrane
0.1Western blot+++Membrane
1.0Western blot++Membrane
5.0Western blot-Not detected
0 + 5.0 (K+ readdition)Western blot- (after 2 hours)Degraded

Note: This table represents typical results based on published studies of the Kdp system in Anabaena species .

How can recombinant kdpC constructs be effectively expressed in Anabaena sp.?

Successful expression of recombinant kdpC constructs in Anabaena species requires consideration of several factors:

  • Vector selection: Use shuttle vectors compatible with both E. coli and Anabaena, such as pRL25C or pRL489, which contain appropriate replication origins and selection markers.

  • Promoter selection: For constitutive expression, the strong psbA promoter is effective; for controlled expression, light-inducible promoters like psbA2 or nitrogen-responsive promoters can be used depending on experimental requirements.

  • Transformation method: Conjugation from E. coli to Anabaena using helper plasmids is the most reliable method. Electroporation may work but with lower efficiency.

  • Selection strategy: Use appropriate antibiotics for selection; common markers include neomycin/kanamycin resistance, spectinomycin/streptomycin resistance, or erythromycin resistance.

  • Expression verification: Confirm successful transformation and expression through PCR, Western blotting, and functional assays to measure potassium transport capability.

When designing kdpC constructs, it's crucial to account for the native operon structure and ensure appropriate spacing between genes if expressing multiple components of the Kdp system simultaneously.

What experimental protocols are most effective for studying kdpC function in potassium transport?

To effectively study kdpC function in potassium transport in Anabaena, the following protocols are recommended:

  • Growth assays under potassium limitation: Culture Anabaena strains (wild-type and kdpC mutants) in media with defined potassium concentrations (0-5 mM) and measure growth rates to assess the importance of kdpC for survival under K+ limitation.

  • Radioisotope transport assays: Use 42K+ or 86Rb+ (as K+ analog) to measure potassium uptake kinetics. Compare uptake rates between wild-type and kdpC mutant strains under various conditions.

  • Membrane vesicle ATPase assays: Isolate membrane vesicles from Anabaena and measure K+-dependent ATPase activity to directly assess Kdp function.

  • Fluorescent potassium indicators: Use fluorescent K+ indicators (like PBFI) to track intracellular potassium levels in real-time under different conditions.

  • Electrophysiological measurements: Apply patch-clamp techniques to characterize potassium currents across membranes of wild-type and kdpC mutant cells.

Sample data table for K+ transport activity:

StrainK+ concentration (mM)K+ uptake rate (nmol/min/mg protein)Relative ATPase activity (%)
Wild-type Anabaena0.0145.3 ± 3.2100
kdpC1 deletion mutant0.0118.7 ± 2.142
kdpC2 deletion mutant0.0128.4 ± 2.563
Double kdpC1/C2 mutant0.015.2 ± 0.812
Wild-type + 5mM K+5.08.7 ± 1.115

How can site-directed mutagenesis of kdpC reveal structure-function relationships?

Site-directed mutagenesis of kdpC can provide valuable insights into its structure-function relationships through systematic modification of key residues. Based on sequence conservation and structural predictions, several approaches are recommended:

  • Targeting conserved residues: Identify amino acids conserved across cyanobacterial KdpC proteins and in comparison with E. coli KdpC. These residues likely play crucial roles in protein function or stability.

  • Interface mutagenesis: Target residues predicted to be at the interface with KdpB, as KdpC is believed to stabilize the KdpB subunit. These mutations can help understand subunit interactions.

  • Charge neutralization: Mutate charged residues that may be involved in potassium coordination or protein-protein interactions.

Recommended experimental pipeline:

  • Generate single amino acid substitutions using overlap extension PCR

  • Express mutant constructs in kdpC-deficient Anabaena strains

  • Assess functional consequences through:

    • Growth assays under K+ limitation

    • K+ transport measurements

    • Protein stability and complex formation analysis

    • Structural studies (if possible)

This approach can reveal which regions of KdpC are essential for assembly, stability, or functional activity of the Kdp-ATPase complex.

What insights can transcriptomic analysis provide regarding kdpC regulation in response to environmental stressors?

Transcriptomic analysis of kdpC regulation in Anabaena can reveal complex regulatory networks and stress responses. RNA-seq analysis under various environmental conditions can identify:

  • Co-regulated genes: Genes showing similar expression patterns to kdpC may be functionally related or under common regulatory control.

  • Regulatory elements: Analysis of promoter regions of differentially expressed genes can identify shared regulatory motifs.

  • Cross-talk between stress responses: Connections between potassium limitation and other stressors like nitrogen limitation, osmotic stress, or light stress.

Suggested experimental design for transcriptomic analysis:

ConditionK+ concentration (mM)Other variablesBiological replicates
Control5.0Standard growth conditions3
K+ limitation0.1Standard growth conditions3
Severe K+ limitation0.01Standard growth conditions3
K+ limitation + osmotic stress0.1200 mM NaCl3
K+ limitation + nitrogen limitation0.1No combined nitrogen3
K+ limitation + high light0.1200 μmol photons m-2 s-13

Previous research suggests that under extreme K+ starvation, expression of the Kdp system becomes insensitive to osmotic signals in both Anabaena and E. coli, indicating that K+ signal dominates over turgor perturbations . Transcriptomic studies can further elucidate these regulatory hierarchies.

How does the dual operon system (kdp1 and kdp2) in Anabaena provide selective advantages compared to single operon systems?

The presence of two distinct kdp operons (kdp1 and kdp2) in Anabaena species represents an intriguing evolutionary adaptation not found in many other bacteria. This dual system likely provides several selective advantages:

  • Functional specialization: The two kdp operons may be optimized for different conditions or cellular functions. For example, one might be specialized for normal potassium homeostasis while the other activates under extreme limitation or stress conditions.

  • Differential regulation: The two operons might respond to different regulatory signals or show different expression thresholds, allowing fine-tuned responses to varying degrees of potassium limitation.

  • Redundancy and robustness: Dual systems provide backup capacity, ensuring potassium homeostasis even if one system is compromised by mutation or environmental factors.

  • Heterocyst-vegetative cell differentiation: In filamentous cyanobacteria like Anabaena, the two kdp systems might play different roles in different cell types, particularly relevant for nitrogen-fixing heterocysts which have distinct metabolic requirements.

Research investigating differential expression patterns of kdp1 and kdp2 operons under various conditions and in different cell types could provide valuable insights into the adaptive significance of this dual system.

What complexities arise when investigating the interaction between potassium homeostasis and nitrogen fixation in recombinant Anabaena strains?

Investigating the interaction between potassium homeostasis (mediated by KdpC and other transporters) and nitrogen fixation in recombinant Anabaena presents several complex challenges:

  • Metabolic interdependence: Nitrogen fixation is an energy-intensive process that depends on proper cellular energetics, which in turn requires appropriate ion gradients maintained partly by potassium transporters .

  • Developmental considerations: Heterocyst differentiation and function may have different potassium requirements compared to vegetative cells, complicating whole-filament studies.

  • Multiple regulatory networks: Both potassium transport and nitrogen fixation are regulated by overlapping environmental factors and signaling pathways, making it difficult to isolate specific interactions.

  • Technical challenges: Simultaneous measurement of potassium transport and nitrogenase activity presents methodological difficulties.

Research approach recommendations:

  • Create strains with controlled expression of kdpC (inducible promoters)

  • Use non-invasive methods to monitor intracellular K+ levels in heterocysts vs. vegetative cells

  • Perform time-course experiments tracking K+ transporter expression during heterocyst differentiation

  • Employ metabolomic approaches to identify metabolic connections between K+ homeostasis and nitrogen fixation

Data from recombinant Anabaena strains with enhanced nitrogen fixation capabilities suggest that proper functioning of all cellular systems, including ion transport, is crucial for optimal nitrogen fixation performance .

How can researchers address issues with inconsistent kdpC expression in laboratory cultures?

Inconsistent kdpC expression in laboratory cultures of Anabaena can arise from several factors. Here are systematic approaches to troubleshoot these issues:

  • Strictly control potassium levels: Since kdpC expression is highly sensitive to K+ concentration, ensure all media components are carefully prepared with defined K+ levels. Even trace contamination from glassware can affect expression .

  • Monitor culture density: Cell density can affect nutrient uptake rates and potassium depletion from media. Standardize experiments to consistent culture densities.

  • Account for light-dependent effects: Light intensity affects photosynthesis, which in turn influences cellular energetics and potentially kdp expression. Maintain consistent light conditions.

  • Standardize growth phase: KdpC expression may vary with growth phase. Always use cultures at the same growth stage.

  • Check for spontaneous mutations: The kdp system is under strong selective pressure during K+ limitation. Sequence-verify strains regularly to ensure genetic stability.

Common issues and solutions:

IssuePossible causesTroubleshooting steps
No kdpC expression despite K+ limitationPotassium contaminationVerify actual K+ concentration in media; use plastic labware when possible
Mutations in regulatory regionsSequence-verify the kdp operon and regulatory regions
Premature kdpC expressionMedia K+ depletionMonitor K+ levels throughout growth; adjust initial concentration
Variable expression between replicatesInconsistent K+ depletion ratesStandardize inoculum density and growth conditions precisely

What analytical challenges arise when interpreting kdpC functional data across different cyanobacterial species?

When comparing kdpC function across different cyanobacterial species, researchers encounter several analytical challenges that require careful consideration:

  • Evolutionary divergence: Sequence and functional divergence of KdpC between species can lead to different kinetic properties and regulatory mechanisms.

  • Different operon structures: While Anabaena has two kdp operons with unique features like kdpG, other cyanobacteria may have different operon organizations . For example, Synechocystis sp. PCC6803 has only one kdp operon.

  • Species-specific physiological contexts: Different cyanobacterial species inhabit various ecological niches with different K+ availability, potentially leading to adaptations in their potassium transport systems.

  • Technical differences in experimental systems: Different model organisms may require different experimental approaches, making direct comparisons challenging.

Recommendations for cross-species comparisons:

  • Perform phylogenetic analysis of KdpC sequences before functional comparisons

  • Consider cellular context (unicellular vs. filamentous, heterocystous vs. non-heterocystous)

  • Use standardized experimental conditions whenever possible

  • Include E. coli KdpC as a well-characterized reference point

  • When appropriate, express genes from different species in a common host to normalize cellular context

How should researchers interpret conflicting data between in vitro and in vivo studies of KdpC function?

When faced with conflicting results between in vitro and in vivo studies of KdpC function, researchers should consider the following factors and interpretations:

  • Complex physiological context: In vivo, KdpC functions within a complex cellular environment with multiple interacting systems, while in vitro studies often isolate components, potentially missing important interactions.

  • Post-translational modifications: KdpC may undergo cellular modifications not replicated in vitro, affecting its function or interactions.

  • Membrane environment effects: The lipid composition and organization of biological membranes can significantly influence membrane protein function - an effect difficult to replicate in vitro.

  • Assembly differences: The Kdp complex assembly process in vivo may differ from reconstitution approaches in vitro.

Reconciliation approach:

  • Bridge the gap with intermediate systems: Use membrane vesicles or spheroplasts that maintain some cellular context while allowing more controlled experimental manipulation.

  • Refine in vitro conditions: Systematically adjust in vitro conditions (ionic strength, lipid composition, presence of other cellular components) to better match cellular environments.

  • Use complementary techniques: Combine structural studies, biochemical assays, and in vivo functional assays to build a comprehensive picture.

  • Consider both perspectives valid: In some cases, differences between in vitro and in vivo results may reveal interesting biological phenomena rather than experimental artifacts.

What emerging technologies could advance our understanding of kdpC function in Anabaena?

Several cutting-edge technologies show promise for advancing our understanding of kdpC function in Anabaena:

  • Cryo-electron microscopy: High-resolution structural analysis of the entire Kdp complex in Anabaena could reveal unique structural features compared to E. coli and explain functional differences.

  • Single-cell analyses: Techniques like single-cell RNA-seq or microfluidics-based approaches could reveal cell-type specific expression patterns within Anabaena filaments, particularly differences between heterocysts and vegetative cells.

  • Optogenetics: Light-controlled expression or activity modulation of kdpC could enable precise temporal control of potassium transport, allowing investigation of acute responses.

  • CRISPR-Cas9 genome editing: More precise and efficient modification of kdpC and related genes can facilitate detailed structure-function studies.

  • Synthetic biology approaches: Designing synthetic kdp operons with modified regulatory elements could reveal the logic of the natural regulatory systems.

  • Advanced imaging techniques: Fluorescent protein tagging combined with super-resolution microscopy could reveal subcellular localization and dynamics of KdpC in different cell types and under different conditions.

These technologies, especially when used in combination, have the potential to resolve current knowledge gaps regarding the unique features of the Anabaena Kdp system compared to other bacteria.

How might systems biology approaches enhance our understanding of the role of kdpC in cellular homeostasis?

Systems biology approaches offer powerful frameworks for understanding kdpC's role within the broader context of cellular homeostasis in Anabaena:

A systems approach is particularly valuable for understanding how the dual kdp operon system in Anabaena is integrated into cellular physiology and how it contributes to the organism's adaptation to its ecological niche as a nitrogen-fixing cyanobacterium .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.