Recombinant Anabaena variabilis ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Anabaena variabilis ATP Synthase Subunit b' (atpG)

Anabaena variabilis is a filamentous cyanobacterium known for its nitrogen-fixing capabilities and photosynthetic activity . ATP synthase is a crucial enzyme complex responsible for ATP (adenosine triphosphate) production, the primary energy currency of cells, through chemiosmosis . The ATP synthase complex consists of two main components: F0 and F1 . Subunit b' (atpG) is a component of the F0 sector, which is embedded in the membrane and facilitates proton transport .

Recombinant Anabaena variabilis ATP synthase subunit b' (atpG) refers to the protein produced using recombinant DNA technology. Specifically, the gene encoding the atpG subunit from Anabaena variabilis is cloned and expressed in a host organism, such as Escherichia coli, to produce large quantities of the protein . The recombinant protein can then be isolated and used for various research purposes, including structural studies, functional assays, and vaccine development .

Research Applications

  • Structural Studies: Recombinant atpG can be used in X-ray crystallography or cryo-electron microscopy to determine the atomic structure of the b' subunit and its interactions with other subunits in the F0 sector .

  • Functional Assays: The isolated protein allows researchers to investigate the role of the b' subunit in proton transport and ATP synthesis . Site-directed mutagenesis can identify key residues involved in these processes .

  • Engineering Cyanobacteria: Modifying cyanobacterial strains for enhanced photobiological production using recombinant atpG is feasible . This has implications for sustainable energy production, such as hydrogen production .

Product Specs

Form
Lyophilized powder
Lead Time
Delivery time varies depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C or -80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Ava_2614; ATP synthase subunit b'; ATP synthase F(0 sector subunit b'; ATPase subunit II; F-type ATPase subunit b'; F-ATPase subunit b'
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
atpG
Target Protein Sequence
MTHWITLLAVEEVAKEGGLFDLDATLPLMAIQFLLLALVLNATLYKPLGKAIDGRNEYVR NNQLEAQERLSKAEKLAEAYEQELAGARRQAQTIIADAQAEAQKIAAEKVAAAQKEAQAQ REQAAGEIEQQKQQALASLEQQVDALSRQILEKLLGADLVKQR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b' subunit is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0. It's a divergent, duplicated form of the b subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

How does atpG differ between heterocysts and vegetative cells in Anabaena?

Unlike some other metabolic genes in Anabaena that show clear differential expression between heterocysts and vegetative cells, current research suggests that ATP synthase components including atpG are present in both cell types, though possibly with different expression patterns. This is similar to the differential expression seen with sucrose phosphate synthase genes (SPS-A and SPS-B) in Anabaena, where SPS-B is expressed in both heterocysts and vegetative cells while SPS-A is restricted to vegetative cells . The presence of ATP synthase in heterocysts is essential for maintaining energy production in these specialized nitrogen-fixing cells, which have altered bioenergetic demands compared to vegetative cells .

What expression systems are commonly used for producing recombinant atpG?

E. coli is the predominant expression system used for recombinant production of Anabaena variabilis atpG. The protein is typically expressed with an N-terminal His-tag for purification purposes . The E. coli system offers advantages including:

  • High protein yield

  • Well-established induction protocols

  • Compatibility with standard purification techniques

  • Cost-effectiveness for research purposes

The protein can be expressed as a full-length construct (163 amino acids) and purified using affinity chromatography .

How can recombinant atpG be used to study ATP synthase assembly and function?

Recombinant atpG provides a valuable tool for investigating ATP synthase assembly mechanisms in cyanobacteria. Research approaches include:

  • Structural studies: Purified recombinant atpG can be used in X-ray crystallography or cryo-EM studies to determine the three-dimensional structure of the protein and its interactions within the ATP synthase complex.

  • Protein-protein interaction studies: Techniques such as pull-down assays, using the His-tagged recombinant atpG, can identify interaction partners within the ATP synthase complex and potentially reveal novel assembly factors.

  • Reconstitution experiments: Recombinant atpG can be used in reconstitution experiments to assess the minimal components needed for functional ATP synthase assembly.

  • Site-directed mutagenesis: By creating specific mutations in the recombinant atpG protein, researchers can identify critical residues involved in ATP synthase assembly and function.

The methodology typically involves expressing and purifying the recombinant protein, followed by biochemical and biophysical characterization of its properties and interactions .

What's the relationship between nitrogen fixation in Anabaena and ATP synthase function?

The relationship between nitrogen fixation and ATP synthase in Anabaena variabilis represents a complex bioenergetic interplay:

  • Energy demands: Nitrogen fixation in heterocysts is an energetically expensive process requiring significant ATP input, which is supplied in part by ATP synthase activity.

  • Metabolic coordination: Similar to the regulation of genes involved in sucrose metabolism (e.g., spsB), ATP synthase components like atpG may be regulated by nitrogen availability through transcription factors such as NtcA .

  • Hydrogen metabolism connection: The regulation of ATP synthase may be indirectly connected to hydrogen metabolism in Anabaena. Uptake hydrogenase (encoded by hupSL) recycles hydrogen produced during nitrogen fixation, and its expression is regulated by nitrogen availability through NtcA . This suggests a coordinated regulation of energy-generating systems during nitrogen fixation.

  • Carbon-nitrogen balance: ATP synthase function is likely integrated with the carbon metabolism pathways that support nitrogen fixation. Research has shown that sucrose metabolism is differentially regulated in heterocysts versus vegetative cells , indicating specialized energy production systems in nitrogen-fixing cells.

A comprehensive experimental approach would include comparative analysis of ATP synthase activity and expression under different nitrogen conditions, in wild-type versus nitrogen fixation mutants, and in heterocysts versus vegetative cells.

How can machine learning approaches improve atpG structure-function analysis?

Integrating machine learning (ML) with experimental data on ATP synthase subunit b' can enhance research in several ways:

  • Structural prediction: ML algorithms can predict structural features of atpG and its interactions with other ATP synthase subunits, potentially identifying critical interaction interfaces.

  • Functional domain identification: Deep learning approaches can identify conserved functional domains within atpG that may not be apparent from sequence analysis alone.

  • Regulatory network prediction: ML can help model the regulatory networks controlling atpG expression, integrating data on transcription factors like NtcA with expression patterns under different environmental conditions.

  • Efficient experimental design: Similar to how ML has been applied to improve Automatic Test Pattern Generation (ATPG) by reducing backtracking in circuit testing , ML can optimize experimental designs for atpG characterization by predicting which mutations or conditions will be most informative.

Implementation would typically involve training neural networks on existing protein structure and function datasets, then applying these models to predict properties of atpG that can guide experimental validation .

What is the optimal protocol for purifying recombinant His-tagged atpG?

For optimal purification of His-tagged recombinant Anabaena variabilis ATP synthase subunit b', the following protocol is recommended:

Materials required:

  • Ni-NTA affinity resin or IMAC column

  • Lysis buffer: Tris-PBS-based buffer, pH 8.0

  • Wash buffer: Lysis buffer with 20-40 mM imidazole

  • Elution buffer: Lysis buffer with 250-300 mM imidazole

  • Storage buffer: Tris-based buffer with 6% Trehalose, pH 8.0, 50% glycerol

Purification procedure:

  • Harvest E. coli cells expressing His-tagged atpG by centrifugation

  • Resuspend cell pellet in lysis buffer and disrupt by sonication

  • Clarify lysate by centrifugation at 15,000 × g for 30 minutes at 4°C

  • Apply supernatant to pre-equilibrated Ni-NTA column

  • Wash with 10 column volumes of wash buffer

  • Elute bound protein with elution buffer

  • Dialyze against storage buffer

  • Verify purity by SDS-PAGE (should exceed 90%)

  • Aliquot and store at -20°C/-80°C

Reconstitution recommendations:
For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 50% for long-term storage at -20°C/-80°C .

Note: Repeated freeze-thaw cycles should be avoided. For multiple use, store working aliquots at 4°C for up to one week .

What assays can be used to study the functional properties of recombinant atpG?

Several complementary assays can be employed to characterize the functional properties of recombinant atpG:

Assay TypeMethodologyInformation ObtainedLimitations
Binding assaysSurface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)Binding kinetics and affinity between atpG and other ATP synthase subunitsRequires purified interaction partners
ATP synthesis assaysLuciferin/luciferase-based ATP detection in reconstituted proteoliposomesFunctional contribution of atpG to ATP synthesisComplex reconstitution requirements
Structural integrity assaysCircular dichroism (CD) spectroscopySecondary structure composition and stabilityLimited structural resolution
Cross-linking studiesChemical cross-linking followed by mass spectrometryIdentification of interaction interfacesPotential artifacts from cross-linking chemistry
Localization studiesFluorescence microscopy with GFP-tagged atpGCellular localization in AnabaenaExpression of fusion protein may alter function

For most comprehensive results, combining multiple assay types is recommended to correlate structural properties with functional characteristics .

How can Top-Off ATPG methodology be applied to optimize experimental design for atpG research?

While Top-Off ATPG (Automatic Test Pattern Generation) is primarily used in electronic circuit testing , its methodological framework can be adapted to optimize experimental designs in atpG research:

  • Prioritized testing approach: Similar to Top-Off ATPG's hierarchical testing approach that reduces pattern volume by 34% while maintaining coverage , researchers can prioritize high-impact experiments first (e.g., key conserved residues) before conducting comprehensive mutational analyses.

  • Coverage optimization: Just as Top-Off ATPG aims to detect multiple fault models with minimal test patterns , experimental designs for atpG can be optimized to test multiple hypotheses with minimal experimental conditions.

  • Machine learning integration: Following the approach of using artificial neural networks to guide ATPG and reduce computational complexity , machine learning can be applied to predict which experimental conditions or mutations will yield the most informative results about atpG function.

  • Fault simulation analogy: In atpG research, different experimental perturbations (mutations, environmental conditions) can be viewed as "fault models," with each experiment designed to detect specific functional changes.

Implementation would involve:

  • Creating a comprehensive list of potential experiments (analogous to test patterns)

  • Ranking them based on their information value

  • Conducting the highest-ranked experiments first

  • Using results to inform subsequent experimental design

  • Employing machine learning to continually refine the experimental approach

How is atpG expression regulated in response to environmental conditions?

The expression of atpG in Anabaena variabilis likely responds to multiple environmental factors similar to other bioenergetic genes:

  • Nitrogen availability: Based on studies of related metabolic genes in Anabaena, atpG expression may be regulated by nitrogen availability through the global nitrogen regulator NtcA. This transcription factor has been shown to regulate numerous genes involved in nitrogen metabolism and energy production, including hydrogenase genes (hupSL) .

  • Light intensity: As a component of the photosynthetic ATP production machinery, atpG expression likely responds to changes in light intensity, though specific data for this subunit is limited.

  • Carbon availability: Studies on sucrose metabolism genes in Anabaena show differential regulation based on carbon availability , suggesting that ATP synthase components may follow similar patterns.

  • Cell differentiation: Expression patterns may differ between heterocysts and vegetative cells, similar to the pattern observed with sucrose phosphate synthase genes (SPS) .

  • Oxygen levels: The microaerobic environment of heterocysts may influence atpG expression, as seen with hydrogenase genes .

A comprehensive analysis of atpG expression would require techniques such as:

  • RT-qPCR under various conditions

  • Reporter gene fusions (similar to the GFP fusions used to study sps genes)

  • Promoter analysis to identify regulatory elements

  • Chromatin immunoprecipitation (ChIP) to confirm transcription factor binding

What role does atpG play in the bioenergetics of nitrogen fixation in Anabaena?

ATP synthase subunit b' (atpG) plays several crucial roles in supporting nitrogen fixation in Anabaena variabilis:

  • ATP production for nitrogenase: Nitrogen fixation requires substantial ATP input, with the nitrogenase enzyme consuming 16 ATP molecules to reduce one N₂ molecule to two NH₃. ATP synthase provides this energy currency, with atpG maintaining the structural integrity needed for efficient catalysis.

  • Energy balance in heterocysts: In heterocysts, where nitrogen fixation occurs, ATP synthase must function in a specialized microaerobic environment. The atpG subunit helps maintain proper ATP synthase structure under these conditions.

  • Integration with carbon metabolism: ATP synthase activity is linked to carbon metabolism pathways that support nitrogen fixation. Similar to the relationship between sucrose synthesis and nitrogen fixation , ATP production via ATP synthase likely coordinates with carbon flux to support energy demands.

  • Coordination with hydrogen metabolism: The expression of hydrogenase genes (hupSL) that recycle hydrogen produced during nitrogen fixation is regulated by nitrogen availability . ATP synthase components may be co-regulated with these systems to optimize energy efficiency.

The bioenergetic role of atpG is best studied through comparative analyses of wild-type and mutant strains under nitrogen-fixing versus non-nitrogen-fixing conditions, using techniques such as:

  • Oxygen consumption measurements

  • ATP production assays

  • Membrane potential measurements

  • Electron transport chain activity assays

What are common challenges in working with recombinant atpG and how can they be addressed?

Researchers working with recombinant Anabaena variabilis ATP synthase subunit b' (atpG) frequently encounter several challenges:

ChallengeCauseSolution
Poor expressionCodon bias in E. coliUse codon-optimized gene or specialized E. coli strains (Rosetta, CodonPlus)
Protein insolubilityHydrophobic regions in atpGExpress at lower temperatures (16-18°C); use solubility tags (SUMO, MBP); optimize buffer conditions
Protein instabilityProteolytic degradationAdd protease inhibitors; express in protease-deficient strains; optimize purification speed
Low purityNon-specific binding to purification resinIncrease imidazole in wash buffers; add two-step purification (e.g., ion exchange after IMAC)
Loss of activityImproper folding or loss of cofactorsInclude proper cofactors in buffers; verify structure by CD spectroscopy; optimize storage conditions
AggregationImproper buffer conditionsAdd stabilizing agents (trehalose, glycerol); optimize ionic strength; consider detergents for hydrophobic regions

For optimal results, storing working aliquots at 4°C for up to one week and avoiding repeated freeze-thaw cycles is recommended . The storage buffer composition (Tris-based buffer with 6% Trehalose, pH 8.0, 50% glycerol) has been optimized for this protein .

How can structural studies of atpG contribute to understanding ATP synthase assembly?

Structural characterization of atpG can provide crucial insights into ATP synthase assembly and function:

  • Interface mapping: Structural studies can identify the specific residues involved in interactions between atpG and other ATP synthase subunits, revealing the molecular basis of complex assembly.

  • Conformational dynamics: Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal the dynamic aspects of atpG structure during ATP synthase function.

  • Evolutionary conservation: Structural comparison of atpG from different organisms can highlight conserved features essential for function versus species-specific adaptations.

  • Assembly pathway elucidation: By studying the structure of intermediate complexes containing atpG, researchers can map the assembly pathway of the complete ATP synthase.

  • Rational design of mutants: Structural insights enable the rational design of point mutations to test specific hypotheses about atpG function.

Methodological approaches include:

  • X-ray crystallography of isolated atpG or subcomplexes

  • Cryo-electron microscopy of larger assemblies

  • NMR spectroscopy for dynamic regions

  • Computational modeling and molecular dynamics simulations

  • Cross-linking mass spectrometry to validate structural predictions

These approaches have been successfully applied to studying other membrane protein complexes and can provide valuable insights into the specific role of atpG in ATP synthase function and assembly .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.