Recombinant Anabaena variabilis Cytochrome b6-f complex iron-sulfur subunit 1 (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Ava_0385; Cytochrome b6-f complex iron-sulfur subunit 1; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
petC
Target Protein Sequence
MAQFSESVDVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPATGGAGGGTTAKDEL GNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVVESKEAITDYGINAVCTHLGCVVPWNAA ENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTPWTETDFRTGEEPWWS
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does it play in Anabaena variabilis?

The cytochrome b6f complex (Cyt b6f) serves as a critical component in both linear and cyclic electron transport pathways during oxygenic photosynthesis in cyanobacteria including Anabaena variabilis. This complex consists of four large subunits responsible for organizing the electron transfer chain within the complex, which have counterparts in the cytochrome bc1 complex found in other bacteria. Additionally, four small subunits unique to oxygenic photosynthesis are present, though their precise functions remain under investigation .

In Anabaena variabilis, the cytochrome b6f complex plays pivotal roles in:

  • Mediating electron transfer between photosystem II and photosystem I

  • Contributing to proton gradient formation across thylakoid membranes

  • Facilitating state transitions between photosystems

  • Supporting both linear and cyclic electron transport

Research demonstrates that disruption of the complex through mutation of even small subunits like PetN significantly impacts photosynthetic function, with oxygen evolution activity decreasing to approximately 30% of wild-type levels .

How does the iron-sulfur subunit (petC) contribute to electron transport in the cytochrome b6-f complex?

The iron-sulfur subunit encoded by the petC gene contains a [2Fe-2S] cluster that functions as an essential electron carrier within the complex. This subunit accepts electrons from the Qo site following the oxidation of plastoquinol and transfers them to cytochrome f, representing a critical step in the electron transport chain.

The proper functioning of petC is essential for:

While specific mutations in petC have not been directly characterized in the available literature for Anabaena variabilis, research on related subunits indicates that disruption of complex components significantly impairs photosynthetic electron transport capabilities .

What are the most effective methods for isolating and expressing recombinant petC from Anabaena variabilis?

Isolation and expression of recombinant petC generally follows a systematic approach:

  • Gene amplification: PCR amplification of the petC gene from Anabaena variabilis genomic DNA using specific primers that incorporate appropriate restriction sites

  • Cloning strategy: Insertion into an expression vector containing:

    • A strong, inducible promoter (e.g., T7)

    • Appropriate fusion tags (His-tag, GST) for purification

    • Sequences optimized for the expression host

  • Expression system selection: E. coli strains specialized for membrane-associated protein expression (e.g., C41(DE3) or C43(DE3))

  • Culture conditions optimization:

    • Temperature reduction (18-25°C) during induction

    • Controlled induction with lower IPTG concentrations

    • Extended expression periods (16-24 hours)

  • Extraction and purification:

    • Membrane fraction isolation

    • Solubilization with appropriate detergents

    • Affinity chromatography followed by size exclusion chromatography

For successful expression, researchers should carefully consider codon optimization for the host organism and potentially co-express chaperone proteins to facilitate proper folding of this membrane-associated component.

How can researchers effectively reconstitute the cytochrome b6-f complex with recombinant petC?

Reconstitution of functional cytochrome b6-f complex represents a significant challenge. Methodological approaches include:

  • Co-expression strategies:

    • Polycistronic expression of multiple complex subunits

    • Sequential induction of different components

    • Use of specialized expression hosts

  • In vitro reconstitution:

    • Isolation of individual components

    • Controlled reassembly in defined lipid environments

    • Verification of complex integrity through biochemical and spectroscopic methods

  • Key parameters for successful reconstitution:

    • Lipid composition optimization

    • Detergent selection and concentration

    • Presence of specific cofactors

    • Controlled redox environment

Researchers should validate reconstitution success through functional assays, including electron transfer activity measurements and spectroscopic analysis of redox center properties.

What spectroscopic techniques are most informative for characterizing the [2Fe-2S] cluster in recombinant petC?

Several complementary spectroscopic techniques provide valuable information about the [2Fe-2S] cluster:

TechniqueInformation ProvidedExperimental Considerations
EPR SpectroscopyRedox state, electronic structure, and magnetic properties of the Fe-S clusterRequires cryogenic temperatures; samples must be properly poised at specific redox potentials
UV-Visible AbsorptionAbsorption characteristics related to Fe-S coordination and environmentRelatively accessible technique; affected by sample purity and concentration
Mössbauer SpectroscopyOxidation states and electronic environment of iron centersRequires isotopic labeling with 57Fe; specialized equipment
Resonance RamanVibrational modes of the Fe-S cluster, reporting on bond strengths and coordinationRequires specific excitation wavelengths; sample concentration optimization
Circular DichroismSecondary structure elements and potential conformational changesSample purity critical; low signal-to-noise for specific Fe-S signals

The combination of these techniques provides comprehensive characterization of the cluster environment and properties, enabling detailed structure-function correlations.

How does the loss of petC affect the stability and function of the cytochrome b6-f complex?

While specific data on petC deletion in Anabaena variabilis is not directly reported in the available literature, insights can be drawn from studies of other subunit mutations. Research on PetN, one of the small subunits, demonstrates that its deletion significantly destabilizes the complex, with several important consequences:

  • Complex integrity: The amount of large subunits decreased to 20-25% of wild-type levels

  • Photosynthetic capacity: Oxygen evolution activity decreased to approximately 30% of wild-type levels

  • Electron transport properties: Both linear and cyclic electron transfer became partially insensitive to typical inhibitors

  • State transitions: Complete abolishment of state transitions, as revealed by 77K fluorescence spectra

Given petC's central role in electron transfer within the complex, its deletion would likely cause even more profound disruption to complex assembly and function, potentially rendering the complex completely non-functional rather than merely destabilized.

How do heterocyst formation and nitrogen fixation influence cytochrome b6-f complex distribution in Anabaena filaments?

Anabaena species are filamentous cyanobacteria capable of differentiating specialized cells called heterocysts under nitrogen-limiting conditions. Heterocysts serve as the site of nitrogen fixation by the oxygen-sensitive enzyme nitrogenase . This cellular differentiation has significant implications for photosynthetic complexes like cytochrome b6-f:

  • Differential expression: Heterocysts exhibit altered photosynthetic apparatus, with an estimated 15-25% of the Anabaena genome transcribed exclusively in heterocysts

  • Oxygen management: Heterocysts inactivate oxygen-generating photosystem II while maintaining PSI and cyclic electron flow, which has implications for cytochrome b6-f distribution and function

  • Metabolic specialization: The heterocyst-vegetative cell relationship creates a metabolic division of labor requiring specialized electron transport configurations

  • Research approaches: Investigating complex distribution requires:

    • Cell-type specific isolation techniques

    • Fluorescent tagging of complex components

    • Advanced microscopy methods to visualize complex localization

    • Quantitative proteomics comparing heterocysts and vegetative cells

Studies examining the spatial arrangement and abundance of cytochrome b6-f components in heterocyst-forming filaments would provide valuable insights into how electron transport is adjusted to support both photosynthesis and nitrogen fixation simultaneously.

What methodologies are most reliable for studying the electron transfer kinetics involving petC?

Investigating electron transfer kinetics requires sophisticated techniques that can capture transient states and rapid reactions:

  • Time-resolved absorption spectroscopy:

    • Flash photolysis with microsecond to millisecond resolution

    • Tracking specific spectral changes associated with redox transitions

    • Mathematical modeling of kinetic components

  • Electrochemical approaches:

    • Protein film voltammetry

    • Construction of electron transfer models based on potential-dependent kinetics

    • Determination of rate constants under varying conditions

  • Advanced biophysical methods:

    • Stopped-flow spectroscopy

    • Freeze-quench EPR

    • Rapid freeze-quench followed by spectroscopic analysis

  • Computational modeling:

    • Molecular dynamics simulations of electron transfer pathways

    • Quantum mechanical calculations of energetic barriers

    • Integration of experimental data with theoretical frameworks

What considerations are important when designing site-directed mutagenesis experiments targeting petC?

Site-directed mutagenesis of petC requires careful planning and consideration of several factors:

  • Target selection:

    • Conserved residues coordinating the [2Fe-2S] cluster

    • Surface residues mediating interactions with other complex components

    • Regions involved in conformational changes during electron transfer

  • Mutation strategy:

    • Conservative vs. non-conservative substitutions

    • Charge preservation or alteration

    • Introduction of spectroscopic or structural probes

  • Expression system compatibility:

    • Codon optimization for expression host

    • Potential impacts on protein stability and folding

    • Incorporation of purification tags that don't interfere with structure

  • Functional assessment:

    • Spectroscopic characterization of mutant proteins

    • Assembly into the complete complex

    • Electron transfer kinetics measurements

    • In vivo complementation studies

How can genetic knockouts and complementation studies be efficiently conducted in Anabaena variabilis?

Genetic manipulation of Anabaena variabilis requires specialized approaches due to its filamentous nature and unique genetic properties:

  • Knockout generation:

    • Homologous recombination with suicide vectors

    • CRISPR-Cas9 systems adapted for cyanobacteria

    • Transposon mutagenesis followed by screening (as demonstrated for identifying heterocyst-related genes )

  • Complementation approaches:

    • Replicative shuttle vectors containing the wild-type gene

    • Integration of complement at neutral genome sites

    • Inducible expression systems to control complementation timing

  • Phenotypic analysis:

    • Growth under various conditions (fixed nitrogen vs. diazotrophic)

    • Oxygen evolution measurements

    • Fluorescence parameters indicating electron transport efficiency

    • 77K fluorescence spectra to assess photosystem stoichiometry and energy distribution

  • Verification methods:

    • RT-PCR and Western blotting to confirm expression

    • Functional assays specific to cytochrome b6-f activity

    • Microscopic assessment of filament morphology and heterocyst formation

The Fox- phenotype (inability to fix nitrogen in the presence of oxygen) serves as a useful screening approach for mutations affecting the photosynthetic apparatus, as demonstrated in studies identifying numerous heterocyst-related genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.