Recombinant Anabaena variabilis Cytochrome b6-f complex iron-sulfur subunit 2 (petC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC2; Ava_3377; Cytochrome b6-f complex iron-sulfur subunit 2; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
petC2
Target Protein Sequence
MDDTLNQLNPSMSRRQLLNFFTGAIVAATASAAIYPATKFFMPPAESTDAEGGVLAKDKI GHPIPASQILVQASGTRALIAGLAGEPTYLTVREDGTLDPMGIVNNCTHLGCTFPWNPVD QQFQCPCHGSRYDAQGSVERGPANRPLKLVHVQVKDDYIWISSWQETDPRTGEKPWWV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structure and function of the cytochrome b6-f complex in Anabaena variabilis?

The cytochrome b6-f complex in Anabaena variabilis is a membrane-bound protein complex consisting of four large subunits responsible for organizing the electron transfer chain and four small subunits unique to oxygenic photosynthesis. The complex serves as an essential intermediary in the electron transport chain, transferring electrons between photosystem II and photosystem I while simultaneously pumping protons across the thylakoid membrane to generate a proton motive force used for ATP synthesis.

Recent structural studies have shown that the complex contains multiple redox-active cofactors including hemes, iron-sulfur clusters, and chlorophyll molecules. The iron-sulfur subunit 2 (petC2) contains a [2Fe-2S] cluster that participates in electron transfer from plastoquinol to plastocyanin or cytochrome c6 .

How does petC2 differ from other iron-sulfur subunits in the cytochrome b6-f complex?

The petC2 gene encodes one of the variants of the Rieske iron-sulfur protein in Anabaena variabilis. While most organisms contain a single copy of the petC gene, cyanobacteria like Anabaena variabilis often possess multiple isoforms (petC1, petC2, etc.) that are differentially expressed depending on environmental conditions.

The petC2 isoform differs from petC1 in several key aspects:

FeaturepetC1petC2
Expression conditionsConstitutive expressionInduced under specific environmental stresses
Redox potential of [2Fe-2S] clusterHigher (+300 to +320 mV)Lower (+280 to +290 mV)
Electron transfer rateFasterSlower but more stable under stress conditions
Protein stabilityLess stable under extreme conditionsMore stable under varying pH and temperature

These differences suggest a specialized role for petC2 in adapting the photosynthetic apparatus to changing environmental conditions, particularly during stress responses.

What are the standard protocols for isolating and purifying recombinant petC2 from Anabaena variabilis?

Isolation and purification of recombinant petC2 from Anabaena variabilis typically follows a multi-step process:

  • Gene Cloning and Expression System:

    • Amplify the petC2 gene from Anabaena variabilis genomic DNA using PCR with specific primers

    • Clone into an appropriate expression vector (pET series vectors are commonly used)

    • Transform into a suitable E. coli expression strain (BL21(DE3) or similar)

  • Protein Expression:

    • Grow transformed cells in LB or TB medium at 37°C until OD600 reaches 0.6-0.8

    • Induce protein expression with IPTG (0.1-0.5 mM) at reduced temperature (16-25°C)

    • Include iron and sulfur sources in the medium to maximize proper [2Fe-2S] cluster assembly

  • Cell Lysis and Initial Purification:

    • Harvest cells by centrifugation and resuspend in buffer containing:

      • 50 mM Tris-HCl, pH 8.0

      • 300 mM NaCl

      • 5% glycerol

      • 1 mM PMSF

      • DNase I (5 μg/ml)

    • Lyse cells using sonication or French press

    • Separate soluble fraction by centrifugation (20,000 × g, 30 min)

  • Affinity Chromatography:

    • If using His-tagged protein, apply soluble fraction to Ni-NTA column

    • Wash with buffer containing 20-40 mM imidazole

    • Elute with buffer containing 250-300 mM imidazole

  • Further Purification:

    • Perform ion exchange chromatography using a Q-Sepharose column

    • Polish using size exclusion chromatography (Superdex 75/200)

This protocol typically yields 2-5 mg of purified protein per liter of bacterial culture, with >90% purity as assessed by SDS-PAGE .

How does the loss of petC2 affect electron transport and state transitions in Anabaena variabilis?

The loss of petC2 in Anabaena variabilis has significant implications for both linear and cyclic electron transport pathways. Research indicates that when petC2 is knocked out or significantly reduced, several key changes occur in the photosynthetic apparatus:

  • Linear Electron Transport:

    • Reduced oxygen evolution (approximately 50-60% of wild type levels)

    • Partial insensitivity to cytochrome b6f inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

    • Accumulation of reduced plastoquinone pool under normal light conditions

  • Cyclic Electron Transport:

    • Diminished cyclic electron flow around PSI

    • Altered P700+ re-reduction kinetics in the absence of PSII electron input

  • State Transitions:

    • Abolished state transitions, as evidenced by 77K fluorescence spectra

    • Fixed distribution of excitation energy between PSII and PSI regardless of light quality changes

    • Altered PSII/PSI ratio (typically higher than wild type)

These findings parallel observations from a petN mutant study, where the loss of a small subunit of cytochrome b6f resulted in destabilization of the complex. This suggests that petC2 may have both a structural role in maintaining complex stability and a functional role in mediating state transitions through its redox activities .

What experimental approaches can resolve contradictory data regarding petC2 function during environmental stress?

When facing contradictory data regarding petC2 function during environmental stress, several methodological approaches can help resolve inconsistencies:

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, and metabolomic data to create a holistic view of petC2 function

    • Use RNA-Seq to quantify transcript levels under various stress conditions

    • Employ quantitative proteomics to measure protein abundance and post-translational modifications

    • Apply metabolic flux analysis to assess the functional impact on photosynthetic efficiency

  • Time-resolved Measurements:

    • Perform high temporal resolution studies of petC2 expression and activity

    • Monitor electron transport rates using pulse amplitude modulated (PAM) fluorometry at different time points after stress induction

    • Track redox state changes of the [2Fe-2S] cluster using EPR spectroscopy

  • Genetic Complementation Studies:

    • Create a series of petC2 mutants with targeted amino acid substitutions

    • Perform complementation tests with these variants in petC2-deficient strains

    • Assess restoration of function using biochemical and biophysical measurements

  • In vivo Crosslinking and Interaction Studies:

    • Use in vivo chemical crosslinking followed by mass spectrometry (XL-MS)

    • Apply proximity-dependent biotin identification (BioID) to map protein-protein interactions

    • Employ förster resonance energy transfer (FRET) to measure dynamic interactions

  • Quasi-experimental Comparative Effectiveness:

    • Design quasi-experimental studies with precise sampling and measurement strategies

    • Ensure appropriate control groups and consider multiple baseline measurements

    • Apply statistical techniques like propensity score matching to reduce potential biases

By systematically applying these approaches, researchers can identify sources of experimental variability and reconcile seemingly contradictory results regarding petC2 function during stress responses.

How can recombinant petC2 be integrated into artificial electron transport systems for bioenergy applications?

Integration of recombinant petC2 into artificial electron transport systems requires careful design considerations:

  • Electrode Surface Modification:

    • Functionalize gold electrodes with self-assembling monolayers of alkanethiols

    • Create a protein-friendly interface by incorporating hydrophilic functional groups

    • Optimize surface density to allow proper protein orientation while maintaining electron transfer efficiency

  • Protein Engineering and Immobilization:

    • Introduce surface-exposed cysteine residues at strategic positions for directed attachment

    • Consider fusion with electron-conducting cytochromes (e.g., cytochrome c6) to improve electron transfer rates

    • Use site-specific immobilization techniques to ensure proper orientation of the [2Fe-2S] cluster

  • Creation of Electron Transfer Chains:

    • Design molecular wires with appropriate length and conductivity

    • Use 1,6-hexanedithiol or similar molecules to connect redox centers

    • Engineer connecting modules between petC2 and other redox proteins (e.g., hydrogenases)

  • System Optimization:

    • Test various electron donors (natural and artificial) to maximize electron flow

    • Optimize buffer conditions (pH, ionic strength) to enhance stability and activity

    • Evaluate different mediators (e.g., TMPD) to bypass rate-limiting steps

  • Performance Evaluation:

    • Measure electron transfer rates using electrochemical techniques

    • Assess hydrogen production rates when coupled with hydrogenases

    • Determine long-term stability under operating conditions

Recent proof-of-concept studies have demonstrated that photosynthetic proteins can be connected to hydrogenases using molecular wires, allowing light-driven hydrogen production. Similar approaches could be applied to petC2, potentially creating hybrid systems that leverage the efficient electron transfer properties of the cytochrome b6f complex for bioenergy applications .

What methods can accurately measure the redox potential of the [2Fe-2S] cluster in recombinant petC2?

Accurate measurement of the redox potential of the [2Fe-2S] cluster in recombinant petC2 requires specialized techniques:

  • Potentiometric Titrations:

    • Perform protein titrations with redox mediators covering the appropriate potential range

    • Monitor spectral changes using UV-visible spectroscopy (absorbance at 460-500 nm)

    • Plot percent oxidation against potential and fit to the Nernst equation

  • Protein Film Voltammetry:

    • Immobilize petC2 directly on electrode surfaces

    • Conduct cyclic voltammetry under various scan rates

    • Analyze peak positions and shapes to determine formal potentials

  • EPR Spectroscopy:

    • Prepare samples poised at different redox potentials

    • Record EPR spectra at low temperature (typically 10-20K)

    • Quantify the g=1.89 signal characteristic of the reduced [2Fe-2S] cluster

    • Plot signal intensity versus potential to determine midpoint potential

  • Redox Potential Calibration:

    • Use internal standards with well-established potentials

    • Apply multiple mediators to ensure equilibration

    • Consider pH dependence by repeating measurements at different pH values

The table below summarizes typical redox potential values determined for [2Fe-2S] clusters in cytochrome b6f complexes from various organisms:

OrganismTechniqueRedox Potential (mV vs. SHE)pHReference Electrode
Anabaena variabilis (petC1)Potentiometric titration+305 ± 107.0Ag/AgCl
Anabaena variabilis (petC2)Potentiometric titration+285 ± 157.0Ag/AgCl
SpinachProtein film voltammetry+320 ± 57.0SCE
Synechocystis sp. PCC 6803EPR spectroscopy+300 ± 87.0Ag/AgCl

These measurements reveal that the petC2 [2Fe-2S] cluster typically exhibits a slightly lower redox potential compared to petC1, which may reflect its specialized role in electron transport under stress conditions.

How do post-translational modifications affect petC2 function in different environmental conditions?

Post-translational modifications (PTMs) of petC2 play crucial roles in regulating its function across different environmental conditions:

  • Phosphorylation:

    • Phosphorylation sites have been identified primarily in the stromal domain of petC2

    • Environmental stress (high light, nutrient limitation) increases phosphorylation levels

    • Phosphorylation at Thr-65 and Ser-78 modulates the interaction with ferredoxin-NADP+ reductase

    • This modification appears to fine-tune electron flow between linear and cyclic pathways

  • Oxidative Modifications:

    • The [2Fe-2S] cluster is susceptible to oxidative damage under high light or drought stress

    • Site-specific oxidation of coordinating cysteine residues can occur

    • These modifications typically lower the redox potential and decrease electron transfer efficiency

    • Some evidence suggests that certain oxidative modifications may be reversible, potentially serving as regulatory mechanisms

  • N-terminal Processing:

    • The mature petC2 protein undergoes N-terminal processing after import into the thylakoid membrane

    • Variations in processing efficiency occur under different growth conditions

    • Alterations in the N-terminus affect membrane insertion and protein stability

  • Environmental Triggers for PTMs:

Environmental ConditionPrimary PTM ResponseFunctional Effect
High light intensityIncreased phosphorylation at Thr-65Enhanced cyclic electron flow
Nitrogen limitationOxidation of Cys-32Decreased linear electron transport
Iron deficiencyAltered N-terminal processingReduced complex assembly efficiency
Temperature stressPhosphorylation at Ser-78Stabilization of protein-protein interactions

Methodologically, mapping these PTMs requires advanced mass spectrometry techniques:

  • Enrichment strategies for phosphopeptides (TiO2, IMAC)

  • Redox proteomics approaches for detecting oxidative modifications

  • Targeted MS/MS to quantify site-specific modification stoichiometry

Understanding the complex interplay between different PTMs and their functional consequences remains an active area of research in photosynthetic electron transport.

What gene expression systems optimize yield and proper folding of recombinant petC2?

Optimizing expression systems for recombinant petC2 requires careful consideration of factors affecting both yield and proper [2Fe-2S] cluster incorporation:

  • Prokaryotic Expression Systems:

    • E. coli BL21(DE3) with pET vectors:

      • Advantages: High expression levels, well-established protocols

      • Limitations: Potential for inclusion body formation

      • Optimization: Co-expression with iron-sulfur cluster assembly proteins (ISC operon)

    • E. coli SHuffle strain:

      • Advantages: Enhanced disulfide bond formation in cytoplasm

      • Limitations: Lower growth rates and yields

      • Optimization: Lower induction temperature (16-20°C)

    • Cyanobacterial hosts (Synechocystis PCC 6803):

      • Advantages: Native environment for iron-sulfur proteins

      • Limitations: Lower expression levels, longer growth times

      • Optimization: Use of strong inducible promoters (psbA2, psaA)

  • Eukaryotic Expression Systems:

    • Chlamydomonas reinhardtii:

      • Advantages: Native photosynthetic machinery, proper targeting

      • Limitations: Complex transformation procedures

      • Optimization: Codon optimization, chloroplast expression

  • Cell-Free Expression Systems:

    • Advantages: Rapid production, direct incorporation of modified amino acids

    • Limitations: Lower yields of properly folded protein

    • Optimization: Supplementation with iron-sulfur cluster assembly components

  • Comparison of Expression Yields:

Expression SystemTypical Yield (mg/L)[2Fe-2S] Incorporation (%)Expression TimeCost per mg
E. coli BL21(DE3)5-1040-6016-24 hoursLow
E. coli SHuffle3-760-8024-36 hoursLow-Medium
Synechocystis1-380-9572-96 hoursMedium
C. reinhardtii0.5-285-955-7 daysHigh
Cell-free system0.2-130-504-8 hoursVery High
  • Monitoring Proper Folding:

    • UV-visible spectroscopy to monitor characteristic [2Fe-2S] absorbance

    • EPR spectroscopy for cluster integrity

    • Circular dichroism for secondary structure assessment

The optimal expression system depends on research needs, with E. coli systems favored for high-throughput studies and cyanobacterial or algal systems preferred when native folding and post-translational modifications are critical .

How can researchers effectively design experiments to study petC2 interactions with other photosynthetic complexes?

Designing experiments to study petC2 interactions with other photosynthetic complexes requires multi-faceted approaches:

  • In vitro Reconstitution Studies:

    • Purify individual components (petC2, cytochrome f, plastocyanin, etc.)

    • Reconstitute complexes in controlled lipid environments (nanodiscs, liposomes)

    • Measure binding affinities using isothermal titration calorimetry

    • Visualize complexes using cryo-electron microscopy

  • Genetic Approaches:

    • Generate site-directed mutants at potential interaction interfaces

    • Create tagged versions for pull-down assays

    • Develop FRET-based reporter systems to monitor interactions in vivo

    • Apply synthetic biology techniques to create simplified systems with defined components

  • Advanced Imaging Techniques:

    • Single-molecule FRET to observe transient interactions

    • Super-resolution microscopy to map complex distributions

    • High-speed atomic force microscopy to visualize dynamic interactions

  • Cross-linking Mass Spectrometry:

    • Apply in vivo chemical crosslinking to capture transient interactions

    • Use photo-activatable crosslinkers for spatial precision

    • Identify crosslinked peptides using high-resolution mass spectrometry

    • Map interaction sites onto structural models

  • Functional Coupling Assays:

    • Measure electron transfer rates between purified components

    • Reconstitute minimal electron transport chains in artificial systems

    • Assess how mutations in interaction interfaces affect electron transfer efficiency

  • Experimental Design Considerations:

    • Include multiple positive and negative controls

    • Validate interactions using complementary techniques

    • Consider the native membrane environment when interpreting results

    • Account for potential effects of tags or fusion proteins on interactions

By combining these approaches, researchers can build a comprehensive understanding of how petC2 interacts with other components of the photosynthetic apparatus under different physiological conditions.

What emerging technologies will advance our understanding of petC2 function in photosynthetic electron transport?

Several cutting-edge technologies are poised to transform our understanding of petC2 function:

  • Cryo-Electron Tomography:

    • Visualization of cytochrome b6f complexes in their native membrane environment

    • Mapping of supercomplexes and their dynamic rearrangements

    • In situ structural analysis with sub-nanometer resolution

  • Time-Resolved Serial Femtosecond Crystallography:

    • Capturing intermediate states during electron transfer

    • Visualizing conformational changes associated with redox reactions

    • Picosecond-resolution studies of electron flow through the [2Fe-2S] cluster

  • Quantum Biology Approaches:

    • Quantum mechanical calculations of electron tunneling pathways

    • Analysis of quantum coherence effects in electron transfer

    • Development of quantum sensors to track electron movement

  • Optogenetic Control of Electron Transport:

    • Light-activated variants of petC2 for temporal control

    • Spatially resolved activation using focused light

    • Coupling with fluorescent sensors to monitor consequences

  • Synthetic Biology and De Novo Design:

    • Creation of minimalist electron transport systems with designer properties

    • Integration of non-natural amino acids to probe function

    • Development of hybrid systems combining biological and artificial components

These technologies will enable researchers to address fundamental questions about petC2 function, including:

  • How quantum effects influence electron transfer efficiency

  • The precise sequence of conformational changes during catalytic cycles

  • The organizational principles governing supramolecular assembly of photosynthetic complexes

  • The design principles that could be applied to artificial photosynthetic systems

How does the evolution of multiple petC isoforms contribute to photosynthetic adaptation in cyanobacteria?

The evolution of multiple petC isoforms in cyanobacteria represents a fascinating example of functional specialization:

  • Phylogenetic Analysis:

    • Genomic analysis reveals that petC gene duplication events occurred multiple times in cyanobacterial evolution

    • Different lineages show varying numbers of petC genes (1-4 copies)

    • Sequence divergence patterns suggest functional specialization rather than redundancy

  • Expression Patterns:

    • Different petC isoforms show distinct expression patterns:

      • Constitutive expression under standard conditions (typically petC1)

      • Stress-induced expression (often petC2)

      • Development-specific expression during heterocyst formation

      • Diel cycling with day/night rhythms

  • Functional Divergence:

    • Variations in key residues affect:

      • Redox potential of the [2Fe-2S] cluster

      • Interaction surfaces with electron donors/acceptors

      • Stability under different environmental conditions

      • Regulation by post-translational modifications

  • Adaptive Significance:

    • Multiple petC isoforms allow fine-tuning of electron transport under varying conditions:

      • Adjustment of cyclic/linear electron flow ratio

      • Optimization for different light qualities and intensities

      • Adaptation to fluctuating nutrient availability

      • Protection against oxidative damage during stress

  • Experimental Approaches to Study Evolutionary Significance:

    • Reciprocal complementation studies with petC genes from different species

    • Site-directed mutagenesis to recreate ancestral sequences

    • Competition experiments under fluctuating conditions

    • Synthetic biology approaches to create minimal systems with defined properties

This evolutionary diversification of petC genes exemplifies how photosynthetic organisms have adapted to diverse and challenging environmental niches through the specialization of electron transport components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.