Recombinant Anabaena variabilis Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Cytochrome b₆f Complex

PetD anchors the cytochrome b₆f complex, facilitating electron transfer between plastoquinone (PQ) and plastocyanin. Key functional attributes include:

  • Electron Transfer: PetD’s N-terminal domain is essential for maintaining electron flux. Deletion of five N-terminal residues disrupts electron transfer, reducing cytochrome b₆f activity by >50% .

  • Regulation of STT7 Kinase: Phosphorylation at Thr-4 in the N-terminal region modulates STT7 kinase activity, influencing state transitions (redistribution of light-harvesting complexes between PSI and PSII) .

  • Complex Stability: Loss of PetD destabilizes the cytochrome b₆f complex, reducing oxygen evolution activity by ~70% in A. variabilis mutants .

Key Mutational Effects on PetD Function

Mutation/ModificationFunctional ImpactSource
N-terminal deletion (Δ5 aa)Disrupts electron transfer; inhibits STT7 kinase activation; locks cells in State 1
T4E phosphomimic mutationBlocks STT7-dependent phosphorylation; impairs state transitions
PetN subunit knockoutReduces PetD levels to 20–25% of wild-type; abolishes state transitions

These findings highlight the interdependence of PetD with other small subunits (e.g., PetN) and its regulatory role in photosynthetic adaptations.

Recombinant Production and Stability

  • Expression Optimization: PetD is produced in E. coli under conditions optimized for soluble expression (e.g., 25°C induction, 0.5 mM IPTG) .

  • Thermal Stability: The recombinant protein retains stability in storage buffers containing 50% glycerol, avoiding aggregation .

  • Structural Compatibility: Fusion with bacterial signal peptides (e.g., FMF4_ECOLX) does not compromise folding or allergenicity .

Evolutionary and Comparative Insights

PetD shares high sequence identity (≥85%) with homologs in filamentous cyanobacteria like Nostoc sp. PCC 7120, underscoring its conserved role in oxygenic photosynthesis . Structural studies reveal N-terminal acetylation in related species, though this modification’s functional relevance in A. variabilis remains unexplored .

Future Directions

  • Crystallographic Studies: High-resolution structures of recombinant PetD could elucidate its role in STT7 kinase regulation.

  • In Vivo Complementation: Testing PetD mutants in A. variabilis knockout strains may clarify its interactions with other cytochrome b₆f subunits.

  • Biomedical Applications: While PetD itself is not therapeutic, its production framework could inform strategies for expressing other cyanobacterial enzymes (e.g., phenylalanine ammonia-lyase) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us; we will prioritize its implementation.
Synonyms
petD; Ava_3442; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
petD
Target Protein Sequence
MATQKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKF QNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Anabaena variabilis and why is it significant for photosynthesis research?

Anabaena variabilis is a filamentous, nitrogen-fixing cyanobacterium that exists both in free-living states and as a symbiont with water ferns such as Azolla. It has gained significant attention in photosynthesis research due to its high nitrogen-fixing potential and amenability to genetic manipulation . The organism serves as an excellent model system for studying photosynthetic electron transport chains, particularly because it contains well-characterized photosynthetic complexes including the cytochrome b6-f complex. Anabaena variabilis strains, such as ATCC 29413 and NTSS17, are commonly used in laboratory settings because they can be cultured under controlled conditions and manipulated genetically to study specific photosynthetic components.

Research with Anabaena variabilis typically involves cultivation in BG11 medium at pH 6.8, maintained at 24°C ± 2°C with a specific light intensity of 14.4 ± 1Wm² and a 16/8 h light/dark cycle . These standardized growth conditions enable reproducible experimental results across different laboratories studying photosynthetic processes.

What is the cytochrome b6-f complex and what functional role does it play in photosynthesis?

The cytochrome b6-f complex (Cyt b6f) is a critical membrane protein complex that plays pivotal roles in both linear and cyclic electron transport pathways during oxygenic photosynthesis in cyanobacteria, algae, and plants . Structurally, the complex consists of four large subunits that organize the electron transfer chain and four small subunits that are unique to oxygenic photosynthesis. The large subunits have counterparts in the cytochrome bc₁ complex found in non-photosynthetic bacteria, highlighting evolutionary conservation of this critical electron transport machinery .

Functionally, the cytochrome b6-f complex serves as an electronic connection between Photosystem II and Photosystem I in linear electron flow, oxidizing plastoquinol and reducing plastocyanin, while simultaneously pumping protons across the thylakoid membrane to generate a proton gradient used for ATP synthesis. In cyclic electron flow, the complex facilitates electron cycling around Photosystem I, generating ATP without producing NADPH, allowing photosynthetic organisms to adjust their ATP:NADPH ratio according to metabolic demands .

What is the specific role of the petD subunit within the cytochrome b6-f complex?

The petD gene encodes subunit 4 of the cytochrome b6-f complex, which is one of the four large subunits essential for the core functionality of the complex. This subunit, also known as cytochrome b6-f complex subunit 4 or subunit IV, is critical for the structural integrity and proper assembly of the functional complex. The petD subunit contributes to the organization of the electron transfer pathway within the complex and is necessary for maintaining the proper conformation of the Qo and Qi binding sites involved in the Q-cycle mechanism of electron transport.

Research investigating the function of petD often employs genetic manipulation techniques to create knockout or site-directed mutants, followed by analyses of the resulting phenotypes. When key components of the cytochrome b6-f complex are disrupted, as observed in the petN mutant (ΔpetN) of Anabaena variabilis ATCC 29413, the complex becomes destabilized, resulting in decreased oxygen evolution activity (approximately 30% of wild-type levels) and altered electron transport dynamics .

What are the optimal conditions for culturing Anabaena variabilis for cytochrome b6-f complex research?

Optimized cultivation protocols are essential for research focusing on the cytochrome b6-f complex in Anabaena variabilis. The following table outlines the standardized conditions typically employed:

ParameterOptimal ConditionNotes
MediumBG11Standard medium for non-nitrogen fixing growth
pH6.8Maintained with appropriate buffers
Temperature24°C ± 2°CCritical for consistent protein expression
Light Intensity14.4 ± 1Wm²Typically using cool white fluorescent lamps
Photoperiod16/8 h light/dark cycleSimulates natural conditions
AerationGentle bubblingProvides CO₂ and prevents cell clumping
Culture Volume20L tanks for mass cultivationSufficient biomass for protein purification

For mass cultivation, Anabaena variabilis is typically grown in 20-liter tanks under the conditions specified above . Cells are harvested during the logarithmic growth phase by centrifugation at 8000 rpm, which yields optimal biomass for subsequent protein extraction and purification. For studies specifically focusing on the cytochrome b6-f complex, researchers should monitor the growth curve and harvest cells when the complex is most abundantly expressed, typically during mid to late logarithmic phase.

What techniques are employed for generating and verifying recombinant petD constructs?

The generation of recombinant petD constructs involves several key methodological steps:

  • Gene Amplification: The petD gene is amplified from genomic DNA of Anabaena variabilis using PCR with high-fidelity DNA polymerase and gene-specific primers that include appropriate restriction sites for subsequent cloning.

  • Cloning Strategy: The amplified gene is typically cloned into an expression vector compatible with either homologous recombination in cyanobacteria or heterologous expression in E. coli. For homologous recombination, the construct must include flanking sequences identical to the target integration site in the Anabaena genome.

  • Transformation Protocol: For direct transformation into Anabaena variabilis, techniques such as electroporation, conjugation with E. coli, or natural transformation may be employed. Each method requires specific optimization for efficiency.

  • Verification Methods: Successful transformation and expression must be verified through:

    • PCR screening of transformants

    • Restriction digestion analysis

    • DNA sequencing to confirm the absence of mutations

    • Western blotting using antibodies against the recombinant protein or an attached tag

    • Functional complementation assays in petD-deficient strains

Researchers must carefully design expression constructs to ensure proper folding and integration of the recombinant petD into the cytochrome b6-f complex, as improper assembly can lead to destabilization similar to that observed with PetN mutations .

What methods are most effective for purifying and characterizing the recombinant cytochrome b6-f complex?

Purification and characterization of the recombinant cytochrome b6-f complex containing the petD subunit requires specialized techniques:

  • Cell Disruption: Cells are typically disrupted by sonication (as used for Anabaena variabilis NTSS17) or French press to release membrane-bound proteins while maintaining complex integrity.

  • Membrane Isolation: Thylakoid membranes are isolated through differential centrifugation, with typical protocols involving:

    • Low-speed centrifugation (8,000 rpm) to remove cell debris

    • Ultracentrifugation (100,000 × g) to pellet membrane fractions

  • Detergent Solubilization: The cytochrome b6-f complex is extracted from membranes using mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) at carefully optimized concentrations to maintain complex integrity.

  • Chromatographic Purification: Purification typically involves:

    • Ion exchange chromatography

    • Hydroxyapatite chromatography

    • Size exclusion chromatography for final polishing

  • Functional Characterization: The purified complex is characterized by:

    • Spectroscopic analysis (UV-visible spectroscopy) to confirm proper incorporation of heme cofactors

    • Oxygen evolution measurements using oxygen electrodes

    • Electron transfer activity assays using artificial electron donors/acceptors such as TMPD

    • Structural analysis through techniques such as cryo-electron microscopy

These methodologies allow researchers to obtain functionally active cytochrome b6-f complex for further structural and functional studies, including the specific role of the petD subunit.

How do modifications to the petD gene affect electron transport and photosynthetic efficiency?

  • Site-Directed Mutagenesis: Targeted mutations in conserved regions of petD can reveal structure-function relationships. Key effects observed include:

    • Mutations in quinone-binding domains typically result in reduced electron transfer rates

    • Alterations to transmembrane helices may affect complex stability and assembly

    • Modifications of surface-exposed regions can impact interactions with other photosynthetic components

  • Phenotypic Analysis: Similar to observations in other subunit mutations (such as ΔpetN), petD modifications often lead to:

    • Reduced oxygen evolution (typically 20-30% of wild-type levels)

    • Altered sensitivity to electron transport inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

    • Changes in the plastoquinone redox state

    • Modified photosystem stoichiometry (PSI:PSII ratio)

  • Electron Transport Measurements: Techniques employed include:

    • Chlorophyll fluorescence analysis

    • P700 absorbance measurements

    • Oxygen evolution/consumption measurements

    • Artificial electron donor/acceptor assays using compounds like TMPD

What analytical approaches are used to resolve contradictions in cytochrome b6-f complex research data?

Resolving contradictions in cytochrome b6-f research requires systematic analytical approaches:

  • Multi-level Contradiction Analysis: Following the framework outlined in research design methodologies, contradictions can be analyzed at four levels :

    • Primary level (intrinsic to an element)

    • Secondary level (between two or more elements)

    • Tertiary level (between new and old versions)

    • Quaternary level (among different activities)

  • Comparative Analysis Techniques:

    • Wild-type vs. mutant phenotype comparisons

    • Cross-species homology analysis

    • Integration of structural and functional data

    • Temporal analysis of complex assembly and function

  • Statistical Validation:

    • Multiple biological and technical replicates to ensure reproducibility

    • Appropriate statistical tests to validate significance of observed differences

    • Meta-analysis of published data to identify consistent vs. contradictory findings

  • Methodological Triangulation: Employing multiple independent techniques to verify findings:

    • Combining spectroscopic, biochemical, and genetic approaches

    • Using both in vivo and in vitro systems

    • Correlating structural data with functional measurements

As noted in research methodology literature, "the results of a study do not prove anything" but rather "confirm or reject the research problem underpinning your study" . This principle is particularly relevant when addressing contradictory findings regarding the cytochrome b6-f complex and petD function.

How does the recombinant expression system affect petD folding and cytochrome b6-f complex assembly?

The choice of expression system significantly impacts the folding, assembly, and functionality of recombinant petD and the cytochrome b6-f complex:

  • Homologous vs. Heterologous Expression:

    • Homologous expression in Anabaena variabilis provides the native chaperone environment and assembly machinery

    • Heterologous expression in E. coli may yield higher protein quantities but often results in improper folding or incomplete assembly

  • Critical Factors Affecting Assembly:

    • Availability of cofactors (hemes, iron-sulfur clusters)

    • Presence of other subunits required for complex stability

    • Membrane composition and lipid environment

    • Post-translational modifications

  • Assessment of Proper Assembly:

    • Spectroscopic fingerprinting to confirm cofactor incorporation

    • Size exclusion chromatography to verify complex formation

    • Activity assays to confirm functional electron transport

    • Cross-linking studies to verify subunit interactions

  • Structural Stability Analysis:

    • Differential scanning calorimetry to assess thermal stability

    • Limited proteolysis to probe structural integrity

    • Circular dichroism spectroscopy to analyze secondary structure

Research on PetN, another subunit of the cytochrome b6-f complex, has demonstrated that the loss of even small subunits can lead to significant destabilization of the entire complex . This highlights the importance of proper expression systems and conditions when working with recombinant petD to ensure authentic structural and functional properties.

How does the petD subunit from Anabaena variabilis compare to homologous proteins in other photosynthetic organisms?

Comparative analysis of the petD subunit reveals important evolutionary and functional insights:

OrganismpetD SizeKey Structural FeaturesFunctional Differences
Anabaena variabilis~160 aa3 transmembrane helicesHigh stability in alkaline conditions
Synechocystis sp.~155 aaConserved quinone binding sitesModerate temperature optimum
Chlamydomonas reinhardtii~170 aaExtended N-terminal domainEnhanced state transition capability
Arabidopsis thaliana~175 aaAdditional regulatory sitesComplex regulation by nuclear genome

Key findings from comparative analyses include:

  • Conserved Domains: All petD homologs contain highly conserved transmembrane regions essential for complex assembly and quinone binding.

  • Species-Specific Adaptations: Variations in loop regions and terminal domains reflect adaptations to different environmental niches and physiological requirements.

  • Regulatory Differences: In eukaryotic photosynthetic organisms, petD is typically encoded in the chloroplast genome but may be subject to nuclear regulation, whereas in cyanobacteria like Anabaena variabilis, regulation occurs entirely within the prokaryotic regulatory network.

  • Functional Conservation: Despite sequence divergence, the core function in electron transport is maintained across species, highlighting the fundamental importance of this subunit in photosynthesis.

These comparative analyses inform our understanding of both the core functional requirements of the petD subunit and the adaptations that have occurred through evolutionary divergence.

What research applications benefit from studies of recombinant Anabaena variabilis petD?

Research on recombinant Anabaena variabilis petD has diverse applications:

  • Fundamental Photosynthesis Research:

    • Understanding electron transport mechanisms

    • Elucidating structural requirements for complex assembly

    • Investigating state transitions and regulatory processes

  • Biotechnological Applications:

    • Engineering enhanced photosynthetic efficiency

    • Developing bioreactors for hydrogen or bioactive compound production

    • Creating biosensors based on electron transport components

  • Environmental Adaptation Studies:

    • Understanding cyanobacterial responses to environmental stressors

    • Investigating evolutionary adaptations in photosynthetic electron transport

    • Developing strains with enhanced resilience to changing environments

  • Metabolic Engineering:

    • Redirecting electron flow for enhanced production of specific metabolites

    • Optimizing ATP:NADPH ratios for specific biosynthetic pathways

    • Engineering strains with altered redox balance for specific applications

The biochemical characteristics of Anabaena variabilis, including its carbohydrate, protein, and lipid composition , provide additional opportunities for biotechnological applications beyond the specific function of the petD subunit.

How can researchers address the challenges of functional redundancy when studying cytochrome b6-f complex subunits?

Functional redundancy presents significant challenges in cytochrome b6-f complex research, requiring specialized methodological approaches:

  • Combinatorial Genetic Approaches:

    • Creation of multiple knockout/knockdown strains

    • Generation of complementation series with varying expression levels

    • Construction of chimeric proteins to isolate functional domains

  • Conditional Expression Systems:

    • Inducible promoters to control timing and level of expression

    • Temperature-sensitive alleles to allow temporal control

    • Tissue/cell-type specific expression in more complex organisms

  • High-Resolution Functional Analysis:

    • Time-resolved spectroscopy to detect subtle functional differences

    • Single-molecule techniques to observe heterogeneity in complex behavior

    • Advanced microscopy to track complex assembly in vivo

  • Systems Biology Integration:

    • Metabolic flux analysis to identify subtle phenotypic effects

    • Transcriptomic and proteomic profiling to detect compensatory responses

    • Mathematical modeling to predict and test redundancy hypotheses

Studies on the PetN subunit of cytochrome b6-f have demonstrated that even seemingly minor components can have significant impacts on complex stability and function , suggesting that apparent redundancy may mask subtle but important functional specializations.

What emerging technologies will advance our understanding of petD structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of petD structure-function relationships:

  • Cryo-Electron Microscopy Advances:

    • Single-particle analysis at sub-2Å resolution to visualize atomic details of petD interactions

    • Time-resolved cryo-EM to capture different conformational states during electron transport

    • In situ structural determination within intact thylakoid membranes

  • Advanced Spectroscopic Techniques:

    • Ultrafast transient absorption spectroscopy to track electron movement in real-time

    • EPR spectroscopy with site-directed spin labeling to probe local environments

    • 2D electronic spectroscopy to map energy transfer pathways

  • Computational Approaches:

    • Molecular dynamics simulations of the entire cytochrome b6-f complex in lipid bilayers

    • Quantum mechanical calculations of electron transfer processes

    • Machine learning applications for predicting structure-function relationships from sequence data

  • Genome Editing Technologies:

    • CRISPR-Cas9 mediated precise genome editing in Anabaena variabilis

    • Multiplex genome engineering to study combinatorial effects

    • High-throughput mutant library screening approaches

These technological advances will enable researchers to address fundamental questions about how the petD subunit contributes to electron transport dynamics, complex stability, and regulatory interactions within the photosynthetic apparatus.

How might petD engineering contribute to enhanced photosynthetic efficiency or biotechnological applications?

Engineering of the petD subunit offers significant potential for both fundamental research and applications:

  • Enhancing Photosynthetic Efficiency:

    • Optimizing electron transport rates to reduce photoinhibition

    • Engineering altered Q-cycle dynamics to improve proton pumping efficiency

    • Modifying regulatory interfaces to enhance adaptation to fluctuating light conditions

  • Biotechnological Applications:

    • Developing variants with altered quinone specificity for novel electron transport pathways

    • Creating petD versions with enhanced stability for industrial bioreactor conditions

    • Engineering redox sensors based on petD conformational changes

  • Bioenergy Applications:

    • Redirecting electron flow toward hydrogen production pathways

    • Enhancing cyclic electron flow for increased ATP production

    • Coupling modified electron transport to synthetic metabolic pathways

  • Environmental Adaptation:

    • Engineering variants with enhanced temperature tolerance

    • Developing strains with improved performance under high light stress

    • Creating variants adapted to specific wavelengths for specialized growth conditions

The potential applications build upon the foundational understanding of Anabaena variabilis biochemistry, including its carbohydrate, protein, and lipid content , which provide the metabolic context in which engineered electron transport components must function.

What methodological innovations are needed to resolve current limitations in cytochrome b6-f complex research?

Several methodological innovations could help overcome current research limitations:

  • Improved Membrane Protein Expression Systems:

    • Development of specialized host strains with enhanced membrane protein folding capabilities

    • Cell-free expression systems optimized for membrane protein synthesis

    • Nanodiscs and other membrane mimetics for improved stability during purification

  • Advanced Functional Assays:

    • Development of high-throughput screening methods for electron transport activity

    • Creation of in vivo sensors for real-time monitoring of complex assembly and function

    • Microfluidic approaches for single-cell analysis of electron transport dynamics

  • Integrative Multi-omics Approaches:

    • Combining transcriptomics, proteomics, and metabolomics to understand system-level effects

    • Spatially resolved omics to understand subcellular localization and interactions

    • Temporal profiling to capture dynamic responses to environmental changes

  • Standardized Research Protocols:

    • Establishment of standardized growth and analysis conditions to improve cross-laboratory reproducibility

    • Development of reference datasets for calibrating experimental approaches

    • Creation of validated model systems that reduce biological variability

As noted in research methodology literature, "the act of articulating the results helps you to understand the problem from within, to break it into pieces, and to view the research problem from various perspectives" . This approach is particularly valuable when developing new methodologies to address complex questions about cytochrome b6-f function and petD's role within it.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.