Recombinant Anabaena variabilis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Properties

Cytochrome b6 (petB) is a core subunit of the cytochrome b6f complex, which facilitates electron transport in both linear (PSII → Cyt b6f → PSI) and cyclic (PSI → Cyt b6f → PSI) pathways in cyanobacteria . Key findings include:

  • Stability Dependence: The complex’s stability requires auxiliary subunits like PetN. Deletion of PetN reduces large subunit levels (e.g., PetB) to 20–25% of wild-type and impairs oxygen evolution (30% activity) .

  • Electron Transfer Roles: TMPD (an electron donor) restores oxygen evolution in ΔpetN mutants, bypassing Cyt b6f, while DBMIB (an inhibitor) affects both linear and cyclic electron flow .

  • State Transition Regulation: Cyt b6f is essential for state transitions (redistribution of light-harvesting complexes between PSII and PSI), as shown by abolished state transitions in ΔpetN mutants .

Functional Studies

  • Electron Transport Modulation: Loss of PetN alters plastoquinone (PQ) redox states and PSII/PSI ratios, highlighting Cyt b6f’s role in balancing electron flow .

  • Inhibitor Sensitivity: ΔpetN mutants show reduced sensitivity to DBMIB, indicating altered PQ binding or conformational changes in the complex .

Challenges and Considerations

  • Structural Instability: The Cyt b6f complex’s stability is highly dependent on auxiliary subunits (e.g., PetN), necessitating careful handling during purification .

  • Tag Variability: Purification efficiency may differ between His-tagged and untagged variants, affecting downstream applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petB; Ava_3441; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
petB
Target Protein Sequence
MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYKP TVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVS GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL TRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Recombinant *Anabaena variabilis* Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Cytochrome b6 in Anabaena variabilis?

Cytochrome b6, encoded by the petB gene (locus Ava_3441) in Anabaena variabilis (ATCC 29413/PCC 7937), is a key component of the cytochrome b6f complex, which plays a critical role in photosynthetic electron transport. This integral membrane protein facilitates electron transfer between photosystem II and photosystem I, contributing to the generation of proton gradient across the thylakoid membrane that drives ATP synthesis. The cytochrome b6f complex serves as an electronic connection between the two photosystems while simultaneously pumping protons across the membrane, making it essential for both linear and cyclic electron transport during photosynthesis .

How does the quinone channeling mechanism in Anabaena variabilis Cytochrome b6f compare to that in plant systems?

Recent high-resolution cryo-EM structural studies of plant cytochrome b6f complexes have revealed a novel "one-way traffic" model for quinone movement and oxidation. In this model, plastoquinones line up head-to-tail near the Qp site, suggesting the existence of a dedicated channel through which quinones flow in one direction. This arrangement allows for efficient quinol oxidation by transiently exposing the redox-active ring during catalysis .

While the specific structure of A. variabilis cytochrome b6f has not been determined at similar resolution, comparative analysis suggests that this one-way traffic mechanism may be evolutionarily conserved across cyanobacteria and plants. Researchers studying the A. variabilis complex should investigate whether similar channeling occurs and how it might be adapted to the cyanobacterial membrane environment. This comparison would provide valuable insights into the evolution of photosynthetic electron transport mechanisms across different photosynthetic organisms .

What approaches can be used to study the interaction between Cytochrome b6 and other components of the photosynthetic electron transport chain in Anabaena variabilis?

Several sophisticated methodologies can be employed to study protein-protein interactions within the photosynthetic apparatus:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized structural studies of membrane protein complexes like cytochrome b6f. For A. variabilis cytochrome b6, researchers should consider protocols similar to those used for plant cytochrome b6f, which involve careful preparation of protein samples using detergent solubilization followed by gradient ultracentrifugation .

  • Crosslinking mass spectrometry: This approach can identify interaction interfaces between cytochrome b6 and other components such as plastocyanin or ferredoxin.

  • FRET (Förster Resonance Energy Transfer): By attaching fluorescent tags to cytochrome b6 and potential interaction partners, researchers can monitor dynamic interactions in near-native conditions.

  • EPR spectroscopy: As demonstrated in plant studies, EPR can provide valuable information about the redox states of cofactors within the cytochrome b6f complex. Samples can be prepared in oxidized and partially reduced states using potassium ferricyanide and sodium ascorbate, respectively, and measured at low temperatures (e.g., 10K) to characterize the electronic properties of the complex .

What are the functional differences between recombinant and native Anabaena variabilis Cytochrome b6?

Recombinant Anabaena variabilis Cytochrome b6 may exhibit subtle functional differences compared to the native protein due to several factors:

  • Post-translational modifications: Native cytochrome b6 undergoes specific modifications in the cyanobacterial cellular environment that may not be replicated in heterologous expression systems.

  • Cofactor incorporation: Proper incorporation of heme groups and iron-sulfur clusters is critical for function and may vary between recombinant and native proteins.

  • Membrane integration: The native protein is co-translationally inserted into thylakoid membranes, while recombinant versions may require refolding or reconstitution.

To assess these differences, researchers should conduct comparative activity assays measuring the cytochrome b6f-mediated reduction of plastocyanin. This can be done by monitoring spectrophotometric changes after preparing substrates such as oxidized plastocyanin using potassium ferricyanide, which is subsequently removed through concentration-dilution cycles . Additionally, optical spectroscopy comparing the absorption profiles of native and recombinant proteins in oxidized and reduced states can reveal differences in cofactor environment and incorporation.

What are the optimal conditions for expressing recombinant Anabaena variabilis Cytochrome b6 in heterologous systems?

Expressing membrane proteins like cytochrome b6 presents significant challenges due to their hydrophobic nature and cofactor requirements. Based on experimental approaches used for similar proteins, the following optimization strategies are recommended:

  • Expression system selection: E. coli-based systems with specialized strains (C41, C43) designed for membrane protein expression often yield better results than standard strains.

  • Temperature modulation: Lower expression temperatures (16-20°C) typically improve proper folding and reduce inclusion body formation.

  • Induction parameters: Optimal results are generally achieved with lower inducer concentrations and extended expression periods (16-24 hours).

  • Media supplementation: Adding δ-aminolevulinic acid (a heme precursor) at 0.5-1.0 mM can enhance heme incorporation into the recombinant protein.

  • Fusion partners: N-terminal fusions with MBP or SUMO tags can improve solubility while maintaining a free C-terminus, which is important for proper folding of cytochrome b6.

The full-length protein (amino acids 1-215) should be included in the expression construct to ensure proper structure and function . After expression, purification typically involves membrane isolation followed by detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations of 0.5-1%.

What spectroscopic methods are most effective for analyzing the functional properties of Cytochrome b6?

Several complementary spectroscopic approaches provide valuable insights into cytochrome b6 structure and function:

  • Optical absorption spectroscopy: This fundamental technique can be performed at room temperature using a diode array spectrophotometer. Samples should be prepared in both oxidized (using potassium ferricyanide) and reduced (using sodium dithionite) states to obtain difference spectra that reveal characteristic absorption peaks of the heme groups .

  • Electron Paramagnetic Resonance (EPR) spectroscopy: For detailed analysis of the electronic properties of cofactors, EPR measurements should be conducted at low temperatures (approximately 10K) using a spectrometer equipped with a liquid helium cryostat. Typical measurement parameters include:

    • Microwave frequency: ~9.4 GHz

    • Microwave power: ~6.4 mW

    • Modulation amplitude: 1.5 mT at 100 kHz

    • Conversion time: ~164 ms

    • Sweep time: ~670 s

  • Circular Dichroism (CD) spectroscopy: This technique provides information about secondary structure elements and can be used to compare native and recombinant protein folding.

  • Resonance Raman spectroscopy: Particularly useful for examining the heme environment and coordination state within the protein.

The data collected from these complementary approaches should be integrated to develop a comprehensive understanding of the protein's functional properties and redox behavior.

What purification strategy yields the highest activity for recombinant Anabaena variabilis Cytochrome b6?

A multi-step purification approach is recommended to obtain highly active recombinant cytochrome b6:

  • Initial membrane preparation: After cell disruption (e.g., by sonication with parameters of 100% power, 30s pulse length, 60s interval, 8min total), membranes containing the expressed protein should be isolated by ultracentrifugation at approximately 148,000g .

  • Detergent solubilization: Solubilize the membrane fraction using a gentle detergent like DDM (0.5-1%) in a buffer containing stabilizing agents such as glycerol (10-20%) and appropriate salt concentrations (100-200 mM NaCl).

  • Affinity chromatography: If the recombinant protein contains an affinity tag, this provides the first purification step. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective.

  • Ion exchange chromatography: This intermediate step removes contaminants with different charge properties.

  • Size exclusion chromatography: As a final polishing step, gel filtration separates protein aggregates and concentrates the purified protein.

  • Sucrose gradient ultracentrifugation: For highest purity, sucrose gradient ultracentrifugation (e.g., 15-30% sucrose gradient, centrifuged at ~150,000g for 16 hours at 4°C) can provide exceptional results .

The purified protein should be stored in an optimized buffer (typically containing Tris, 50% glycerol) at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that can diminish activity .

How does the "one-way traffic" model for quinone movement affect our understanding of Cytochrome b6f function?

Recent high-resolution structural studies of plant cytochrome b6f have revealed a groundbreaking mechanism for quinone movement during electron transport. According to this model, plastoquinones line up head-to-tail near the quinone oxidation site (Qp), suggesting the existence of a channel through which quinones flow unidirectionally. This arrangement allows for efficient quinol oxidation by transiently exposing the redox-active ring during catalysis .

This discovery has profound implications for understanding electron transport in cyanobacteria like Anabaena variabilis:

  • Implications for electron transfer kinetics: The one-way traffic model explains how efficient quinol oxidation can occur despite the thermodynamically challenging nature of this reaction.

  • Evolutionary considerations: The mechanism appears to be distinct from that observed in cytochrome bc1 complexes, raising questions about convergent evolution in electron transport systems.

  • Regulatory potential: The channeling of quinones provides a potential regulatory point for controlling electron flow between linear and cyclic electron transport pathways.

Researchers studying A. variabilis cytochrome b6f should consider investigating whether similar channeling mechanisms exist in this cyanobacterial system and how they might be adapted to the specific membrane environment and electron transport requirements of these organisms .

What experimental techniques have advanced our structural understanding of Cytochrome b6f complexes?

Recent advances in structural biology have revolutionized our understanding of cytochrome b6f complexes:

These complementary approaches have collectively contributed to our understanding of how cytochrome b6f functions at the molecular level. For Anabaena variabilis specifically, applying these techniques would provide valuable insights into any cyanobacteria-specific features of the complex that may differ from plant systems .

How do auxiliary subunits regulate Cytochrome b6f function in cyanobacteria compared to plants?

Research on cytochrome b6f complexes has identified important differences in auxiliary subunits between cyanobacteria and plants that affect regulation of electron transport:

In cyanobacteria like Anabaena variabilis, the PetP subunit plays a critical regulatory role in balancing cyclic electron transport (CET) and linear electron transport (LET). This cyanobacteria-specific subunit has no direct homolog in plant systems .

In contrast, plants contain a thylakoid soluble phosphoprotein of 9 kDa (TSP9) that binds to cytochrome b6f in a region similar to where PetP binds in cyanobacteria. Despite the lack of sequence homology, these proteins appear to serve analogous functions in regulating the balance between cyclic and linear electron transport pathways .

This evolutionary divergence represents a fascinating example of how different photosynthetic organisms have developed distinct regulatory mechanisms to control electron flow through cytochrome b6f. Researchers investigating A. variabilis cytochrome b6f should focus on characterizing the specific interactions between PetP and the core complex to understand how this regulation occurs at the molecular level.

What are common challenges in maintaining recombinant Cytochrome b6 stability and how can they be addressed?

Recombinant cytochrome b6 presents several stability challenges that researchers should anticipate:

  • Aggregation during storage: The hydrophobic nature of cytochrome b6 makes it prone to aggregation. This can be mitigated by storing the protein in buffer containing 50% glycerol and avoiding repeated freeze-thaw cycles. For optimal preservation, store stock solutions at -20°C or -80°C for extended periods, while keeping working aliquots at 4°C for no longer than one week .

  • Loss of cofactors: Heme groups may dissociate during purification and storage. Including stabilizing agents like glycerol and maintaining reducing conditions can help preserve cofactor association.

  • Oxidative damage: The redox-active centers in cytochrome b6 are susceptible to oxidative damage. Maintaining anaerobic conditions during purification and including reducing agents (at low concentrations) in storage buffers can protect against oxidation.

  • Detergent effects: The choice of detergent significantly impacts stability. While DDM is commonly used, testing a panel of detergents (including newer amphipols and nanodiscs) may identify optimal conditions for specific experimental applications.

  • Temperature sensitivity: Purified cytochrome b6 may denature at room temperature over extended periods. Perform all experimental manipulations at 4°C whenever possible, and monitor protein integrity by absorption spectroscopy before conducting activity assays.

How can researchers reconcile differences between in vitro and in vivo data when studying Cytochrome b6 function?

Addressing discrepancies between in vitro biochemical data and in vivo physiological observations is a common challenge when studying membrane proteins like cytochrome b6:

What are the emerging research directions for Anabaena variabilis Cytochrome b6 studies?

Future research on Anabaena variabilis cytochrome b6 is likely to focus on several promising directions:

  • Structural biology: Applying cutting-edge cryo-EM approaches to determine high-resolution structures of A. variabilis cytochrome b6f in different functional states, similar to recent advances in plant systems .

  • Regulatory mechanisms: Investigating how PetP and other regulatory proteins modulate cytochrome b6f activity to balance linear and cyclic electron transport in response to changing environmental conditions.

  • Evolutionary adaptations: Comparative studies between cyanobacterial and plant cytochrome b6f complexes to understand how structural and functional differences reflect adaptations to different ecological niches.

  • Synthetic biology applications: Exploring the potential of engineered cytochrome b6 variants to enhance photosynthetic efficiency or enable novel biotechnological applications.

  • System-level integration: Understanding how cytochrome b6f functions within the broader context of photosynthetic and respiratory electron transport networks in cyanobacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.