Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ycf4; Ava_1241; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
ycf4
Target Protein Sequence
MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASGFLLAGISSYLKV NLLIVTDPTQLIFVPQGLVMGLYGTAGLLLASYLWLAILWDLGGGYNDFNRETGNIKIFR WGFPGKNRKIEIGSRIQDIQSVRIDIKEGLNPRRALYLRVKGRRDIPLTRVGQPLSLAEL ETQGAQLARFLGVPLEGL
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein essential for the accumulation and assembly of Photosystem I (PSI). Studies in Chlamydomonas reinhardtii have demonstrated that Ycf4 is critical for photoautotrophic growth, as cells lacking Ycf4 are unable to grow photoautotrophically due to PSI deficiency . The protein appears to function as a scaffold for PSI assembly, facilitating the organization of newly synthesized PSI polypeptides into a functional complex . Unlike structural components of PSI, Ycf4 is not permanently incorporated into the mature PSI complex but rather assists in its assembly process .

How conserved is the Ycf4 protein across photosynthetic species?

Comparative sequence analysis reveals that Ycf4 is highly conserved across diverse photosynthetic organisms. The Chlamydomonas reinhardtii Ycf4 demonstrates significant sequence identity with homologues from land plants (43.2–48.6%), Euglena gracilis (41.3%), Odontella sinensis (47.5%), Cyanophora paradoxa (49.7%), Porphyra purpurea (52.2%), and the cyanobacterium Synechocystis sp. strain PCC 6803 (45.8%) . This conservation suggests evolutionary importance for photosynthetic function across various taxonomic groups. Based on these homologies, recombinant Anabaena variabilis Ycf4 likely shares significant structural and functional characteristics with these other photosynthetic organisms.

What structural features characterize the Ycf4 protein?

The Ycf4 protein contains two putative transmembrane α-helices within its N-terminal portion, a structural feature conserved across species . In Chlamydomonas reinhardtii, Ycf4 is slightly larger than its homologues due to a 14 amino acid insertion between the two transmembrane domains . Despite these hydrophobic regions that could potentially serve as membrane anchors, biochemical studies have shown that both Ycf4 and Ycf3 (another PSI assembly factor) are extrinsic membrane proteins rather than integral membrane proteins, as they can be released from thylakoid membranes by treatment with alkali or chaotropic agents .

What experimental approaches are used to study Ycf4 localization in thylakoid membranes?

Researchers typically employ a combination of biochemical fractionation and immunological detection to study Ycf4 localization. The standard protocol involves:

  • Isolation of intact thylakoid membranes through differential centrifugation

  • Membrane treatment with various agents (detergents, chaotropes, or alkali) to determine the nature of protein association

  • Western blot analysis using Ycf4-specific antibodies raised against recombinant proteins

  • Complementary approaches including immunogold labeling for electron microscopy visualization

These techniques revealed that Ycf4 associates with thylakoid membranes but is not stably bound to the PSI complex itself . The protein's extrinsic nature was confirmed through treatments that release peripheral but not integral membrane proteins.

How does the Ycf4-containing complex participate in PSI assembly?

The Ycf4-containing complex appears to function as a specialized molecular scaffold during PSI biogenesis. Pulse-chase protein labeling experiments revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex . This suggests the complex acts as an assembly platform that facilitates the intricate process of integrating multiple protein subunits and cofactors into the functional PSI complex.

The large size of the Ycf4 complex (>1500 kD) provides sufficient structural capacity to accommodate multiple PSI components simultaneously, enabling coordinated assembly . The complex contains the PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as identified through mass spectrometry and immunoblotting techniques . This association with multiple PSI components at various assembly stages indicates that Ycf4 likely guides the spatial organization of these subunits during the assembly process.

What is the relationship between Ycf4 and COP2 in the thylakoid membrane?

Ycf4 and the opsin-related protein COP2 demonstrate an intimate and exclusive association in thylakoid membranes. Almost all Ycf4 and COP2 in wild-type cells copurify through sucrose gradient ultracentrifugation and subsequent ion exchange column chromatography, indicating a strong interaction between these proteins . This consistent co-purification suggests they form a functional unit within the assembly complex.

Interestingly, when COP2 levels were reduced to approximately 10% of wild-type levels using RNA interference, the salt sensitivity of the Ycf4 complex stability increased, although PSI accumulation was not affected . This observation suggests that while COP2 contributes to the structural stability of the Ycf4 complex under varying ionic conditions, it is not essential for PSI assembly function. The precise role of this retinal-binding protein in the context of photosynthetic complex assembly remains an intriguing area for further investigation.

What purification strategies yield the highest purity and stability of recombinant Ycf4?

For optimal purification of recombinant Ycf4, the following protocol has proven effective based on research with tagged Ycf4:

Table 1: Optimized Purification Protocol for Recombinant Ycf4

StepProcedureCritical ParametersExpected Result
1. ExtractionSolubilization of thylakoid membranes with dodecyl maltoside (DDM)1% DDM concentration; 4°C temperatureSolubilized membrane proteins
2. Affinity Chromatography (1st)Application to IgG agarose column with overnight rotation4°C; complete binding requires extended incubation~90% adsorption of Ycf4 to matrix
3. TEV Protease CleavageRelease of Ycf4 complex from affinity matrixOptimized enzyme:substrate ratio; 16°C temperatureSpecific release of target complex
4. Affinity Chromatography (2nd)Calmodulin resin bindingCalcium-dependent binding; minimal detergentFurther purification of complex
5. Size ExclusionSeparation based on molecular sizeFlow rate <0.5 ml/min; stabilizing bufferIsolation of intact complex

This tandem affinity purification approach has successfully yielded stable Ycf4-containing complexes exceeding 1500 kD in size . The critical innovation is the extended incubation with the first affinity matrix, as the adsorption of TAP-tagged Ycf4 is not initially efficient but reaches approximately 90% after overnight rotation at 4°C .

What methodologies are most effective for characterizing the structural organization of the Ycf4 complex?

Comprehensive structural characterization of the Ycf4 complex requires integrating multiple complementary techniques:

These complementary approaches together provide a comprehensive view of both the composition and structural organization of the Ycf4 complex.

How should researchers approach gene disruption studies of ycf4?

When conducting gene disruption studies of ycf4, researchers should implement the following methodological approach:

  • Selection of Disruption Strategy: For chloroplast genes like ycf4, biolistic transformation with a selectable marker cassette (e.g., aadA conferring spectinomycin resistance) has proven effective . The marker should be inserted at a position that ensures complete disruption of the gene, such as 137 nucleotides downstream from the ycf4 initiation codon as demonstrated in Chlamydomonas reinhardtii .

  • Verification of Homoplasmy: Since chloroplasts contain multiple genome copies, it's critical to verify that all copies carry the disruption. This typically requires:

    • Multiple rounds of single colony purification under selective conditions

    • Southern blot hybridization using gene-specific probes and the selection marker

    • Confirmation by PCR analysis with primers flanking the insertion site

  • Phenotypic Analysis Protocol:

    • Assessment of photoautotrophic growth capabilities

    • Measurement of PSI activity through spectroscopic methods

    • Western blot analysis to evaluate PSI subunit accumulation

    • Evaluation of other photosynthetic complexes to confirm specificity of the effect

  • Controls: Include wild-type strains and, if possible, complemented strains where the wild-type gene is reintroduced to confirm that observed phenotypes result specifically from ycf4 disruption.

Researchers studying ycf4 disruption should anticipate complete loss of photoautotrophic growth capability and severely reduced PSI accumulation, as observed in Chlamydomonas reinhardtii .

What are the key considerations for designing experiments to investigate Ycf4 interactions with PSI components?

When investigating interactions between Ycf4 and PSI components, researchers should consider the following experimental design elements:

Table 2: Experimental Approaches for Studying Ycf4-PSI Interactions

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying direct protein-protein interactionsPreserves native conditions; captures transient interactionsMay lose weak interactions during washing steps
Pulse-chase labelingTracking newly synthesized PSI componentsDistinguishes assembly intermediates from mature complexesComplex experimental setup; requires radioactive materials
Yeast two-hybridMapping specific interaction domainsHigh-throughput screening of multiple interactionsPotential for false positives; may not reflect in vivo conditions
Förster Resonance Energy Transfer (FRET)Measuring proximity of proteins in vivoReal-time visualization in living cells; sensitive to nanometer distancesRequires fluorescent tagging that may affect function
Cross-linking Mass SpectrometryIdentifying interaction interfacesMaps specific amino acid contacts; captures transient interactionsComplex data analysis; potential artifacts from cross-linking

The most informative studies typically combine multiple approaches. For example, tandem affinity purification has successfully identified that the Ycf4-containing complex includes PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF , while pulse-chase labeling demonstrated these associated PSI polypeptides are newly synthesized and partially assembled .

How can researchers effectively analyze the temporal dynamics of Ycf4-mediated PSI assembly?

Analyzing the temporal dynamics of Ycf4-mediated PSI assembly requires sophisticated experimental approaches that can track the process over time:

  • Inducible Expression Systems: Developing systems where Ycf4 expression can be controlled allows researchers to synchronize the initiation of PSI assembly. This can be achieved through:

    • Temperature-sensitive promoters

    • Chemical induction systems

    • Light-regulated expression constructs

  • Time-Resolved Proteomics: Sampling at defined intervals following induction of PSI synthesis enables tracking of the changing composition of assembly intermediates. This should include:

    • Quantitative mass spectrometry to measure relative abundance of components

    • Identification of post-translational modifications that may regulate assembly steps

    • Analysis of both protein and pigment incorporation into the complex

  • Real-time Imaging: Fluorescently tagged components can be used to visualize assembly dynamics in living cells, though care must be taken to ensure tags don't disrupt function.

  • Mathematical Modeling: Integrating experimental data into kinetic models can provide insights into rate-limiting steps and regulatory mechanisms in the assembly process.

A particularly effective approach demonstrated in research is pulse-chase protein labeling, which revealed that PSI polypeptides associated with the Ycf4-containing complex represent assembly intermediates rather than fully mature complexes .

How do conflicting data on Ycf4 necessity across species inform our understanding of PSI assembly?

An intriguing discrepancy exists in the literature regarding the absolute requirement for Ycf4 in PSI assembly across different photosynthetic organisms. While Ycf4 is essential for PSI accumulation in Chlamydomonas reinhardtii , cyanobacterial mutants deficient in Ycf4 can still assemble PSI complexes, albeit at reduced levels . This species-dependent variation offers valuable insights into the evolution of photosynthetic assembly mechanisms and raises important research questions.

These conflicting observations suggest several possibilities:

  • Functional Redundancy: Some organisms may possess redundant assembly factors that can partially compensate for Ycf4 loss. Identifying these alternative assembly pathways could reveal novel mechanisms.

  • Evolutionary Specialization: The increasing dependence on Ycf4 in eukaryotic photosynthetic organisms may reflect adaptation to more complex chloroplast environments compared to prokaryotic cyanobacteria.

  • Structural Adaptation: PSI complexes themselves may have evolved structural differences that influence their dependence on assembly factors.

Researchers investigating Anabaena variabilis Ycf4 should consider designing comparative studies with other cyanobacterial and eukaryotic systems to elucidate the molecular basis for these differences in Ycf4 dependency.

What are the emerging technologies that could advance our understanding of Ycf4 structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of Ycf4's structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM): Recent advances in resolution now enable near-atomic visualization of large protein complexes. Applied to the Ycf4 complex, cryo-EM could reveal the spatial arrangement of components and conformational changes during the assembly process.

  • AlphaFold and Other AI-Based Structure Prediction: These computational approaches can provide structural models of Ycf4 and its interactions with PSI components, generating testable hypotheses about functional domains.

  • Single-Molecule Techniques: Methods such as single-molecule FRET or optical tweezers could track the dynamics of individual assembly events, revealing heterogeneity in assembly pathways not detectable in bulk measurements.

  • In-Cell NMR Spectroscopy: This emerging approach allows structural studies in living cells, potentially revealing how the cellular environment influences Ycf4 structure and interactions.

  • Genome Editing with CRISPR-Cas9: Precise modification of Ycf4 at the genomic level enables systematic structure-function studies through targeted mutations of key residues or domains.

These technologies, especially when combined in integrated research programs, could overcome current limitations in understanding the molecular mechanisms of Ycf4-mediated PSI assembly.

How might variations in experimental conditions affect Ycf4 complex stability and composition?

The stability and composition of the Ycf4 complex are sensitive to experimental conditions, presenting both challenges and opportunities for researchers:

Table 3: Impact of Experimental Variables on Ycf4 Complex Analysis

VariablePotential EffectsOptimization Strategies
Detergent Type/ConcentrationMay disrupt protein-protein interactions; selective solubilizationSystematic comparison of detergents; use minimum effective concentration
Salt ConcentrationAffects electrostatic interactions; COP2-depleted complexes show increased salt sensitivity Titration experiments to determine optimal ionic strength
TemperatureInfluences complex stability; may cause dissociation of weakly bound componentsMaintain consistent low temperature throughout purification
pHAlters protein charge distribution and interactionsBuffer optimization; avoid extreme pH values
Light ConditionsMay affect photosynthetic complex assembly dynamicsControl light exposure during sample preparation

Research has demonstrated that when COP2 levels were reduced to approximately 10% of wild-type levels, the Ycf4 complex showed increased sensitivity to salt, suggesting COP2 contributes to structural stability under varying ionic conditions . This highlights the importance of carefully controlling buffer composition when isolating and characterizing Ycf4 complexes.

Researchers should systematically evaluate how these variables affect experimental outcomes and develop standardized protocols that optimize complex integrity while enabling necessary manipulations for analysis.

What are the implications of Ycf4 research for understanding photosynthetic efficiency and optimization?

Specific applications may include:

  • Identifying rate-limiting steps in PSI assembly that could be targets for optimization

  • Engineering Ycf4 variants with enhanced assembly capabilities

  • Developing strategies to accelerate recovery of photosynthetic capacity following stress-induced damage

  • Understanding species-specific differences in assembly mechanisms to inform cross-species engineering approaches

By elucidating the fundamental process of PSI assembly, Ycf4 research contributes to the broader goal of enhancing photosynthetic efficiency to address global challenges in sustainable energy and food production.

What standardized protocols should researchers adopt when comparing Ycf4 from different species?

When conducting comparative studies of Ycf4 from different species, researchers should adhere to standardized protocols to ensure meaningful comparisons:

  • Sequence Analysis and Alignment:

    • Use consistent algorithms and parameters across all species

    • Generate phylogenetic trees using maximum likelihood methods

    • Identify conserved domains and species-specific variations

  • Expression and Purification:

    • Express proteins under identical conditions where possible

    • Use the same purification strategy across species

    • Verify protein folding and integrity through circular dichroism or limited proteolysis

  • Functional Assays:

    • Develop consistent in vitro assembly assays using defined components

    • Where possible, conduct complementation studies in a single host species

    • Measure activity parameters under identical conditions

  • Structural Characterization:

    • Apply the same structural biology techniques across species

    • Ensure similar protein concentrations and buffer conditions

    • Use standardized data analysis pipelines

Adopting these standardized approaches will facilitate meaningful comparisons that illuminate evolutionary adaptations and conserved mechanisms across diverse photosynthetic organisms, including Anabaena variabilis and other species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.