Recombinant Anabaena variabilis Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Anabaena variabilis Photosystem I Reaction Center Subunit III (psaF)

Anabaena variabilis Photosystem I (PSI) reaction center subunit III, commonly referred to as psaF, is a protein component of the PSI complex in the cyanobacterium Anabaena variabilis . PSI is a multi-subunit complex that facilitates light-dependent electron transfer during photosynthesis . The psaF gene encodes this subunit, which plays a crucial role in the electron transfer processes within PSI .

Recombinant psaF is produced using genetic engineering techniques, where the psaF gene is inserted into a host organism (e.g., E. coli) to express and produce the protein in large quantities . Often, a histidine tag (His-tag) is added to the recombinant protein to simplify purification using affinity chromatography .

Role in Photosynthesis

PSI is critical for the light-dependent reactions of photosynthesis . It absorbs light energy and uses it to drive the transfer of electrons from plastocyanin to ferredoxin . This electron transfer chain generates the reducing power needed to convert carbon dioxide into sugars .

Experimental Analysis and Research Findings

  • Mutagenesis Studies: Targeted inactivation of genes encoding PSI reaction-center proteins (psaA and psaB) in Anabaena variabilis results in cells unable to grow in light, with no PSI-mediated photochemical activity .

  • Spectroscopic Analysis: Mutant strains lacking psaA and psaB genes show a high ratio of phycobilin to chlorophyll, appearing blue . These mutants lack chemically reducible P700, the reaction-center chlorophylls of PSI .

  • Protein Identification: N-terminal amino acid sequences of PSI subunits, including PsaF, have been determined through high-resolution gel electrophoresis, aiding in the identification of gene products like psaK, psaJ, and psaI .

  • Interaction Studies: Site-directed mutagenesis is used to study the interactions between plastocyanin (PC) and PSI. Silene PC specifically cross-links to the PsaF subunit of PSI complexes in Anabaena variabilis .

Applications and Significance

The ability to manipulate PSI reaction-center proteins in Anabaena variabilis makes it a suitable organism for studying photosynthesis . Recombinant PsaF proteins are valuable tools for biochemical and biophysical studies aimed at understanding the structure and function of PSI . Cyanobacteria like Anabaena can be used to produce various chemicals, including alcohols, ketones, fatty acids, and organic acids .

Data Table: PSI Subunit Identification in Anabaena variabilis ATCC 29413

Subunit Molecular Mass (kDa)Corresponding Gene Product
6.8psaK
5.2Unknown
4.8psaJ
3.5psaI

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaF; Ava_1478; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-164
Protein Length
Full Length of Mature Protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
psaF
Target Protein Sequence
LGADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRA GDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGLALPIIATGFAWPAAA VKELLSGELTAKDSEITVSPR
Uniprot No.

Target Background

Function

This protein likely participates in efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein facilitates the specific interaction of plastocyanin with Photosystem I.

Database Links
Protein Families
PsaF family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is PsaF and what is its role in the photosystem I complex?

The protein contains a characteristic region of 17 hydrophobic amino acids in its C-terminal domain that is highly conserved across diverse photosynthetic organisms, including cyanobacteria like Anabaena and eukaryotic algae like Chlamydomonas . This conservation suggests critical functional importance in PSI operation.

How conserved is the PsaF protein sequence across different photosynthetic organisms?

PsaF shows remarkable evolutionary conservation, with high sequence similarity across diverse photosynthetic organisms. Sequence analysis of Flaveria trinervia PsaF (a C4 plant) revealed significant homology with the corresponding protein in spinach (a C3 plant) . The following table summarizes key conservation data:

OrganismTypeRegion of highest conservationNotable features
Anabaena variabilisCyanobacteriumC-terminal domain (17 aa)Hydrophobic region
Flaveria trinerviaC4 plantC-terminal domainFirst psaF gene isolated from a C4 plant
SpinachC3 plantC-terminal domainHigh similarity to F. trinervia protein
ChlamydomonasGreen algaeC-terminal domainConservation pattern similar to cyanobacteria

The high degree of sequence conservation, particularly in the 17-amino acid hydrophobic C-terminal region, suggests critical functional importance that has been maintained throughout evolution across cyanobacteria and higher plants .

What are the optimal conditions for recombinant expression of Anabaena variabilis PsaF in E. coli?

Based on studies of other Anabaena variabilis proteins expressed in E. coli, the following optimized conditions can be applied to PsaF expression:

ParameterOptimized conditionNotes
Expression vectorpET28aProvides N-terminal His-tag for purification
IPTG concentration0.5 mMHigher concentrations may lead to inclusion body formation
Induction temperature25°CLower temperatures improve soluble protein yield
Induction time18 hoursExtended time optimizes protein folding
Culture mediaTB (Terrific Broth)Provides better yields than LB medium
Shaking speed150 rpmModerate agitation improves folding

While these conditions were optimized for Anabaena variabilis phenylalanine ammonia lyase (AvPAL), they provide a rational starting point for PsaF expression due to the similar source organism and potential structural characteristics . Temperature is particularly critical, as lower induction temperatures (25°C) significantly improve the yield of properly folded, soluble protein compared to standard 37°C induction protocols .

What purification strategies are most effective for obtaining high-purity recombinant PsaF?

A multi-step purification strategy is recommended for isolating high-purity recombinant PsaF:

  • Immobilized Metal Affinity Chromatography (IMAC): Using the N-terminal His-tag, purify the protein on Ni-NTA resin with an imidazole gradient (10-250 mM) .

  • Size Exclusion Chromatography: Further purify the IMAC-purified protein on a Superdex 75 or 200 column to separate monomeric PsaF from aggregates and remove remaining contaminants.

  • Ion Exchange Chromatography: If necessary, employ a final polishing step using anion exchange (e.g., Q-Sepharose) or cation exchange (e.g., SP-Sepharose) depending on the calculated pI of the recombinant PsaF.

The recombinant PsaF protein should be stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability . Repeated freeze-thaw cycles should be avoided, and the protein should be stored at -20°C/-80°C with 50% glycerol for long-term storage .

How can researchers assess the proper folding and functionality of recombinant PsaF?

Multiple complementary approaches can be used to verify proper folding and functionality:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure elements and confirm proper folding of the recombinant protein.

  • Limited Proteolysis: Properly folded proteins typically show resistance to proteolytic digestion compared to misfolded variants.

  • Complementation Studies: The gold standard for functional verification is genetic complementation in psaF-deficient mutants. Introduction of the recombinant psaF into mutant strains should restore wild-type phenotypes if the protein is functional .

  • Protein-Protein Interaction Studies: Since PsaF is known to interact with other photosystem components, co-immunoprecipitation or pull-down assays can confirm if the recombinant protein maintains these interactions.

  • Spectroscopic Analysis: Changes in photosystem I kinetics, particularly in cyclic electron flow, can be measured spectroscopically to assess functionality .

What phenotypic changes occur in cyanobacteria when PsaF is absent or mutated?

Studies on photosystem I subunit mutations in cyanobacteria reveal several characteristic phenotypic changes when components are disrupted. While specific psaF mutant phenotypes in Anabaena variabilis are not detailed in the provided search results, related photosystem I mutant studies suggest the following potential effects:

  • Pigmentation Changes: Mutants often display a blue color due to a high ratio of phycobilin to chlorophyll, indicating disruption of normal photosynthetic machinery .

  • Growth Impairment: Inability to grow under light conditions, as the photosystem I functionality is compromised .

  • Photochemical Activity: Loss of PSI-mediated photochemical activity while photosystem II complexes may remain functional .

  • Chlorophyll Content: A significant decrease in the chlorophyll/PSII ratio relative to wild-type cells .

  • Fluorescence Profile: Altered low-temperature (77K) fluorescence spectroscopy profiles, with changes in characteristic peaks that indicate structural alterations in the photosystem complexes .

These phenotypic changes provide useful markers for assessing the functional roles of PsaF and can be used to verify the functionality of recombinant PsaF in complementation experiments.

Can PsaF be used to study interactions between photosystem I and other photosynthetic components?

Recombinant PsaF provides valuable opportunities for studying protein-protein interactions within the photosynthetic apparatus:

  • Phycobilisome Interactions: Research suggests complex interactions between photosystem subunits and phycobilisomes (PBS), the large antenna protein complexes in cyanobacteria. These antenna proteins influence PSI kinetics and contribute to cyclic electron flow around PSI .

  • RRM Domain Protein Interactions: Recent studies have identified interactions between photosystem mRNAs (including psaA) and RNA-binding proteins containing RRM domains. The protein Rbp3 binds to psaA mRNA and affects its accumulation, influencing PSI:PSII ratios . Recombinant PsaF could be used to study whether these RNA-binding proteins also interact with PSI protein components during assembly.

  • Co-immunoprecipitation Studies: Tagged recombinant PsaF can be employed in co-IP experiments to identify novel interaction partners. For instance, FLAG-tagged proteins have been successfully used to identify interacting components in photosynthetic organisms .

  • FISH Analysis: Fluorescent in situ hybridization (FISH) techniques can be combined with recombinant PsaF studies to investigate the spatial organization of PSI assembly. Research has shown that FISH can reveal significant overlap between photosystem components and regulatory factors .

What approaches can be used to study the assembly process of photosystem I using recombinant PsaF?

Several methodological approaches can leverage recombinant PsaF to study PSI assembly:

  • Pulse-Chase Experiments: By introducing recombinant PsaF into cyanobacterial cells at specific timepoints, researchers can track its incorporation into PSI complexes over time.

  • Cryo-EM Structural Analysis: Recent advances in cryo-EM have enabled high-resolution structural determination of photosystem complexes from cyanobacteria. Similar approaches can be applied using systems with recombinant PsaF to capture assembly intermediates .

  • In vitro Reconstitution: Attempting partial or complete reconstitution of PSI complexes using recombinant subunits including PsaF can provide insights into the assembly process and requirements.

  • Mutational Analysis: Strategic mutations in the conserved 17-amino acid hydrophobic region of recombinant PsaF can help determine critical residues for assembly and function .

  • Time-Resolved Fluorescence Spectroscopy: This technique has been successfully employed to compare excitation-energy dynamics between different PSI oligomeric states (tetramers, dimers, and monomers) and could be adapted to study the role of PsaF in these dynamics .

What are the current challenges in expressing and studying membrane proteins like PsaF?

Membrane proteins like PsaF present several challenges for recombinant expression and characterization:

  • Hydrophobicity: The 17-amino acid hydrophobic C-terminal region of PsaF makes expression in soluble form challenging . Strategies to overcome this include:

    • Using specialized membrane protein expression systems like Lemo21(DE3)

    • Adding solubilization tags (e.g., MBP, SUMO)

    • Optimizing detergent conditions for extraction and purification

  • Protein Folding: Ensuring proper folding is critical for functional studies. Optimization parameters include:

    • Lower induction temperatures (25°C produces higher yields of active protein than 37°C)

    • Extended induction periods (18 hours shows better results than shorter periods)

    • Medium composition (TB media outperforms LB for expression of Anabaena proteins)

  • Stability During Purification: The addition of stabilizing agents like trehalose (6%) helps maintain protein integrity during purification and storage .

  • Functional Reconstitution: Demonstrating functionality of the isolated protein remains challenging and often requires reconstitution into liposomes or nanodiscs.

How can directed evolution approaches be applied to engineer PsaF with enhanced properties?

Based on successful directed evolution studies on other Anabaena variabilis proteins, the following approaches could be adapted for PsaF engineering:

  • High-Throughput Screening System: Development of a selection system that couples E. coli growth to PsaF functionality would enable screening of large mutant libraries . This approach has been successfully applied to engineer phenylalanine ammonia-lyase (PAL) from Anabaena variabilis, increasing turnover frequency almost twofold in a single round of engineering .

  • Error-Prone PCR: This technique can generate random mutations throughout the psaF gene. Combining this with a survival-based selection system would allow identification of variants with improved stability or activity .

  • Site-Saturation Mutagenesis: Targeting the conserved 17-amino acid hydrophobic region for comprehensive mutagenesis could identify variants with improved membrane integration or protein-protein interactions .

  • Domain Swapping: Creating chimeric proteins by combining domains from PsaF proteins of different species (e.g., Anabaena variabilis and Synechocystis) could generate variants with novel properties or enhanced stability .

  • Computational Design: In silico approaches to predict stabilizing mutations based on structural data can guide targeted mutagenesis efforts.

The success of directed evolution approaches for engineering Anabaena variabilis proteins has been demonstrated with PAL, where mutations identified through directed evolution increased turnover frequency significantly after only a single round of engineering .

How do studies on PsaF complement research on antenna modifications and nitrogen fixation in cyanobacteria?

Research on PsaF intersects with studies on light harvesting and nitrogen fixation in cyanobacteria:

  • Antenna Modifications: Studies have shown that modification of light-capturing antenna complexes can enhance nitrogen fixation in heterocysts of high light-tolerant cyanobacteria like Anabaena . Understanding how PsaF interacts with these modified antenna systems could provide insights into optimizing photosynthetic efficiency and nitrogen fixation.

  • Cyclic Electron Flow: PsaF, as a component of PSI, contributes to cyclic electron flow, which is crucial for ATP generation in heterocysts. Enhanced cyclic electron flow has been linked to increased nitrogenase activity . Research on PsaF can help elucidate mechanisms to improve this process.

  • PSI:PSII Ratio Manipulation: Studies have shown that deletion of RNA-binding proteins like Rbp3 affects the PSI:PSII ratio and pigment content in cyanobacteria . Since Rbp3 interacts with psaA mRNA, understanding how PsaF assembly is coordinated with other PSI components could reveal new regulatory mechanisms.

  • Heterocyst-Specific PSI Adaptation: Heterocysts of cyanobacteria have approximately 50% more photosynthetic units (chlorophyll a/P700 ratio) than vegetative cells . Investigating how PsaF contributes to this specialization could inform strategies for enhancing nitrogen fixation.

How can knowledge about PsaF contribute to synthetic biology applications in photosynthetic systems?

Understanding PsaF structure and function can contribute to synthetic biology efforts in several ways:

  • Minimal Photosystem Design: Identifying the essential components and interactions required for functional photosystems could enable the design of simplified, synthetic photosynthetic units. PsaF's conserved regions likely represent critical functional elements that would need to be preserved in such designs .

  • Cross-Species Compatibility: The high conservation of PsaF across different photosynthetic organisms suggests it could function in heterologous systems . This property could be exploited in synthetic biology applications that aim to introduce photosynthetic capabilities into non-photosynthetic organisms.

  • Enhanced Light Harvesting: Insights from PsaF's role in photosystem assembly and function could inform strategies to enhance light capture efficiency in both natural and synthetic systems. Recent research on antenna modifications that led to enhanced nitrogenase activity demonstrates the potential impact of such approaches .

  • Modular Photosynthetic Units: Understanding the molecular interactions between PsaF and other photosystem components could enable the design of modular, interchangeable parts for synthetic photosystems with tailored properties.

  • Environmental Adaptation: Studies on leucyl aminopeptidase (LAP) have shown unexpected roles in UV tolerance in cyanobacteria, with implications for photosystem maintenance under stress conditions . Similar research approaches could reveal how PsaF contributes to environmental adaptation, informing synthetic designs for specific environmental conditions.

What control experiments should be included when studying recombinant PsaF function?

Rigorous control experiments are essential for meaningful interpretation of results:

  • Empty Vector Controls: Expression studies should include empty vector controls to account for host cell responses to the expression system itself.

  • Inactive Mutant Controls: Generate a non-functional PsaF mutant (e.g., by disrupting the conserved hydrophobic region) to serve as a negative control for functional assays.

  • Complementation Controls: When performing complementation studies in PsaF-deficient mutants, include both non-complemented mutants and wild-type strains as controls .

  • Species Variation Controls: When comparing PsaF from different species, consider controlling for codon optimization, expression levels, and potential post-translational modifications.

  • Environmental Condition Controls: Photosynthetic performance should be tested under various light intensities, as some phenotypes may only be apparent under specific conditions (e.g., high light, UV exposure) .

  • Trans-Complementation Verification: When complementing mutant strains, verify that the observed phenotype restoration is specifically due to the introduced gene rather than secondary mutations by using multiple independent transformants .

How can researchers integrate transcriptomic and proteomic approaches to study PsaF in the context of photosystem assembly?

Multi-omics approaches provide comprehensive insights into PsaF function:

  • Transcriptome Profiling: RNA-Seq analysis can reveal how psaF gene expression correlates with other photosystem components under different conditions. For example, studies have shown that after 15 minutes of UV exposure, transcripts encoding photosystem I subunits are strongly down-regulated, suggesting coordinated regulation .

  • Ribosome Profiling: This technique can reveal translational dynamics of psaF mRNA and potential regulatory mechanisms. Recent studies have shown that RNA-binding proteins like Rbp3 interact with both psaA mRNA and ribosomes, suggesting translational regulation of photosystem components .

  • Proteomics: Quantitative proteomics can track changes in PsaF abundance relative to other photosystem components under different conditions or in different genetic backgrounds. Mass spectrometry of co-immunoprecipitation fractions can identify proteins physically proximal to PsaF .

  • Protein-RNA Interaction Studies: Techniques like CLIP-seq (cross-linking immunoprecipitation sequencing) can identify RNAs that interact with proteins involved in coordinating psaF expression and assembly. UV cross-linking has been successfully used to identify RNA-protein interactions in photosynthetic organisms .

  • Fluorescent in situ Hybridization (FISH): This technique can visualize the subcellular localization of psaF mRNA and its relationship to translation sites and thylakoid membranes, providing insights into the spatial organization of photosystem assembly .

  • Integrative Data Analysis: Combining these multiple data types can reveal regulatory networks controlling photosystem assembly and identify key control points where PsaF integration occurs.

What are the most promising areas for future research on PsaF and its role in photosystem I?

Several exciting research directions promise to advance our understanding of PsaF:

  • Structural Biology: High-resolution cryo-EM studies of PSI complexes with tagged or modified PsaF could reveal detailed interaction interfaces and conformational changes associated with complex assembly and function .

  • Single-Molecule Studies: Applying single-molecule techniques to study the dynamics of PsaF incorporation into PSI complexes could provide unprecedented insights into assembly kinetics and heterogeneity.

  • Synthetic Biology Applications: Exploring how PsaF can be incorporated into minimal or synthetic photosystems could open new avenues for bioenergy applications and artificial photosynthesis.

  • Environmental Adaptation: Investigating how PsaF structure and function vary across cyanobacterial species adapted to different light environments could reveal evolutionary strategies for optimizing photosynthesis .

  • Cross-Species Complementation: Testing whether PsaF from diverse photosynthetic organisms can functionally complement each other could reveal fundamental insights into the evolution of photosynthetic machinery .

  • Translational Regulation: Further exploration of how RNA-binding proteins like Rbp3 coordinate the expression of photosystem components including PsaF could reveal new regulatory mechanisms controlling photosystem stoichiometry .

With ongoing advances in structural biology, synthetic biology, and systems biology approaches, our understanding of PsaF's role in photosynthesis is poised for significant expansion in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.