Recombinant Anabaena variabilis Photosystem Q (B) protein 3 (psbA3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is synthesized using heterologous expression systems for structural and functional studies:

Table 1: Key Production Details

ParameterDetailsSource
Expression HostEscherichia coli (in vitro cell-free or standard systems)
TagN-terminal 10×His tag for affinity purification
Purity≥85–90% (confirmed by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water + 50% glycerol for stability

Research Applications

  • Photosynthesis Studies: Used to investigate PSII repair cycles under oxidative stress .

  • Nitrogen Fixation: Insights into how PSII inactivation (via D1 isoform switching) protects nitrogenase during heterocyst differentiation .

  • Biotechnology: Serves as a template for engineering stress-tolerant photosynthetic organisms .

Table 2: psbA3 vs. Other D1 Isoforms in A. variabilis

FeaturepsbA3 (Q3MB78)psbA2 (Q3MAB1)psbA1
ExpressionInduced under high lightConstitutiveSuboxic conditions
FunctionElectron transportPrimary PSII activityAlternative PSII repair
Unique ResiduesTyr-161, His-190Gln-158, Asp-170Met-149, Leu-165
Recombinant UseStress response studiesBaseline PSII activityLow-oxygen adaptations

Data derived from .

Challenges and Future Directions

  • Stability Issues: The recombinant protein is sensitive to repeated freeze-thaw cycles, necessitating aliquot storage .

  • Functional Inactivation: Studies in Synechocystis 6803 show that certain D1 isoforms (e.g., sentinel D1) render PSII inactive, highlighting the need for precise isoform characterization .

  • Crystallography: Ongoing efforts to resolve its 3D structure could elucidate mechanisms of photodamage resistance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly shipped with normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA3; Ava_2138; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
psbA3
Target Protein Sequence
MTTTLQQRSSANVWERFCTWITSTENRIYVGWFGVLMIPTLLAATVCFIIAFVAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA3 gene and its protein product in Anabaena variabilis?

The psbA3 gene in Anabaena variabilis encodes the Photosystem Q(B) protein 3, which is part of the D1 protein family crucial for photosystem II function. This protein is a critical component of the photosynthetic electron transport chain, specifically involved in the oxidation of water molecules and the reduction of plastoquinone. The psbA3 gene belongs to a multigene family typical in cyanobacteria, with different copies expressing under varying environmental conditions .

In Anabaena variabilis, as in other cyanobacteria, the psbA3 protein functions within the reaction center of photosystem II. The full-length protein consists of 344 amino acids and plays a fundamental role in light harvesting and energy conversion during photosynthesis .

What is the functional significance of psbA3 in comparison to other photosystem components?

PsbA3 appears to provide enhanced photoprotection compared to other PsbA variants. Research on cyanobacterial psbA genes reveals that PsbA3 (often designated as D1:2) is strongly induced under high light conditions, suggesting an adaptive role in photoprotection .

Functional studies comparing PsbA1 and PsbA3 in Thermosynechococcus elongatus demonstrate that PsbA3-containing PSII complexes offer better protection against photoinhibition. This enhanced protection stems from PsbA3's ability to facilitate the harmless dissipation of excess energy, likely due to altered redox potential of pheophytin toward more positive values .

What are the recommended methods for expressing recombinant psbA3 protein?

For expressing recombinant Anabaena variabilis psbA3 protein, E. coli expression systems have proven effective. The process typically involves:

  • Gene synthesis or PCR amplification of the psbA3 coding sequence

  • Cloning into an appropriate expression vector (often with a His-tag for purification)

  • Transformation into E. coli expression strains

  • Induction of protein expression under optimized conditions

  • Cell harvesting and protein extraction

For enhanced solubility and proper folding, consider:

  • Using specialized E. coli strains designed for membrane protein expression

  • Optimizing induction temperature (often lower temperatures improve folding)

  • Adding solubility-enhancing fusion tags beyond the His-tag

  • Including appropriate chaperones in the expression system

The expressed protein can be confirmed through Western blotting with anti-His antibodies and mass spectrometry verification.

How can researchers accurately quantify different PsbA proteins despite their high sequence similarity?

Quantifying different PsbA proteins presents a significant challenge due to their high sequence homology. Reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS) has been demonstrated as an effective method for accurately distinguishing and quantifying different PsbA variants .

The methodology involves:

  • Sample preparation: Carefully isolate PSII complexes or total membrane proteins

  • Protein digestion: Enzymatic digestion (typically trypsin) to generate peptide fragments

  • LC-MS/MS analysis: Separate peptides by reverse-phase chromatography before mass spectrometry

  • Data analysis: Identify unique peptide signatures specific to each PsbA variant

  • Quantification: Determine relative or absolute quantities based on peptide abundance

For improved accuracy, isotopic labeling can be employed. For example, growing cultures on modified medium containing 15NH4Cl as the sole nitrogen source allows for differential labeling and more precise quantification .

What protocols are recommended for constructing knock-out mutants to study psbA function?

Construction of psbA knock-out mutants requires precise genetic manipulation techniques. Based on established protocols for cyanobacteria, the following approach is recommended:

  • Design plasmid constructs containing:

    • Upstream and downstream regions of the target psbA gene

    • A selectable antibiotic resistance cassette (e.g., chloramphenicol, spectinomycin/streptomycin)

    • Deletion or disruption of most parts of the target gene

  • Transform the wild-type cyanobacterial strain using standard transformation protocols (e.g., for Thermosynechococcus elongatus, reference protocol from publication 12 mentioned in search result 4)

  • Select transformants on media containing appropriate antibiotics

  • Verify complete segregation of the mutant through PCR analysis of genomic DNA

  • Confirm the absence of the target protein expression using immunoblotting or mass spectrometry

For studying multiple psbA genes, sequential or simultaneous deletion strategies can be employed, as demonstrated in the construction of ΔpsbA1/psbA2 and ΔpsbA3 mutants .

How does high light stress affect psbA3 expression and protein accumulation?

Under high light conditions, psbA3 expression is significantly upregulated in cyanobacteria. Research indicates that upon high light incubation, approximately 70% of total PsbA protein consists of PsbA3, which closely corresponds to the transcript level observed .

This light-dependent expression pattern suggests an adaptive response mechanism where PsbA3 replaces the standard PsbA variant (PsbA1) to enhance photoprotection under stress conditions. The correlation between transcript and protein levels indicates efficient translation of psbA3 mRNA under high light conditions .

For experimental studies investigating psbA3 expression under high light, researchers should consider:

  • Defining precise light intensity parameters (μE m−2 s−1)

  • Establishing appropriate time courses for sampling

  • Implementing both transcriptional (RT-qPCR) and translational (MS-based protein quantification) analyses

  • Including appropriate controls to account for circadian regulation

What biophysical methods can effectively differentiate between PsbA variants in functional studies?

Several biophysical techniques have proven effective for distinguishing functional differences between PsbA variants:

  • Thermoluminescence measurements: Detect shifts in the free energy between redox pairs in different PsbA-containing PSII complexes

  • Delayed fluorescence measurements: Complement thermoluminescence data to assess energetic differences

  • Flash-induced fluorescence decay: Evaluate electron transfer kinetics between QA and QB

  • Prompt fluorescence measurements: Assess general PSII functionality and energy transfer efficiency

  • EPR spectroscopy: Examine specific redox components within the photosystem

These techniques revealed that PsbA3-containing complexes exhibit a shift in the redox potential of pheophytin toward more positive values compared to PsbA1-containing complexes, contributing to enhanced photoprotection .

What molecular mechanisms explain the photoprotective advantage of PsbA3?

The photoprotective advantage of PsbA3 appears to stem from alterations in the redox properties of photosystem II components. Research findings suggest the following mechanisms:

  • Altered pheophytin redox potential: PsbA3 complexes exhibit a shift in pheophytin redox potential toward more positive values, which affects the energetics of charge separation and recombination pathways

  • Enhanced energy dissipation: PsbA3 facilitates a higher probability of harmless dissipation of excess excitation energy, reducing the formation of damaging reactive oxygen species

  • Modified electron transfer dynamics: Though no significant differences in QA-QB electron transfer have been observed between PsbA1 and PsbA3 variants, other aspects of electron transport may be optimized in PsbA3

The combined effect of these mechanisms allows PSII complexes containing PsbA3 to maintain functionality under high light conditions that would otherwise cause photoinhibition in complexes containing only PsbA1 .

What are the optimal storage conditions for recombinant psbA3 protein preparations?

For optimal stability and activity of recombinant psbA3 protein preparations, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C in appropriate buffer systems

  • Long-term storage: Store at -20°C/-80°C with the addition of a cryoprotectant such as glycerol (recommended final concentration: 50%)

  • Lyophilization: For extended storage, lyophilized powder formulations can maintain stability

  • Reconstitution protocol:

    • Briefly centrifuge vials prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for subsequent storage

    • Avoid repeated freeze-thaw cycles which can lead to protein denaturation

When handling the recombinant protein, maintaining pH stability (typically pH 8.0) using Tris/PBS-based buffers with additional stabilizers such as trehalose (6%) is advised .

How can researchers effectively design experiments to compare functional properties of different PsbA variants?

To effectively compare functional properties of different PsbA variants, consider the following experimental design principles:

This comprehensive approach allows for robust comparison of variant-specific properties while minimizing experimental artifacts .

How do researchers reconcile contradictory findings regarding psbA3 function across different cyanobacterial species?

Contradictory findings regarding psbA3 function across cyanobacterial species often arise from:

  • Evolutionary divergence: Despite functional conservation, psbA genes have evolved differently across cyanobacterial lineages

  • Nomenclature inconsistencies: Various studies may use different designations for psbA genes (D1:1, D1:2, psbA1, psbA3, etc.)

  • Environmental context: Experimental conditions (light intensity, temperature, nutrient availability) significantly impact psbA expression and function

  • Methodological differences: Variations in experimental approaches may yield apparently contradictory results

To reconcile contradictory findings:

  • Perform phylogenetic analyses of psbA sequences to establish true homology relationships

  • Standardize experimental conditions when comparing across studies

  • Implement systems biology approaches to integrate transcriptomic, proteomic, and functional data

  • Consider the ecological niche of each species and how it may influence psbA function and regulation

By taking these approaches, researchers can build a more coherent understanding of psbA3 function across the cyanobacterial lineage.

What are the implications of psbA3 research for understanding photosynthesis evolution and optimization?

Research on psbA3 and other PsbA variants provides valuable insights into photosynthesis evolution and potential optimization:

  • Adaptive evolution: The diversification of psbA genes represents an adaptive response to varying environmental conditions, particularly light stress

  • Functional specialization: Different PsbA variants have evolved specialized roles (e.g., PsbA3 for high light conditions), demonstrating how photosynthetic organisms optimize their molecular machinery

  • Mechanistic understanding: The altered redox properties of PsbA3 illustrate fundamental principles of photochemistry and electron transport optimization

  • Biotechnological applications: Knowledge of PsbA variants could inform:

    • Engineering of photosynthetic organisms with enhanced stress tolerance

    • Development of artificial photosynthetic systems

    • Optimization of biofuel production in cyanobacteria

  • Climate adaptation insights: Understanding how photosynthetic organisms adapt to varying light conditions provides clues about potential responses to climate change

The continued study of psbA3 and related proteins thus contributes not only to basic science but also to potential applications in sustainable energy and agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.