Recombinant Anabaena variabilis Photosystem Q (B) protein 6 (psbA5)

Shipped with Ice Packs
In Stock

Description

Protein Characterization

Recombinant psbA5 is expressed in E. coli with an N-terminal His-tag for purification. Key biochemical properties include:

PropertyDetails
UniProt IDQ3M5L6
Amino Acid Sequence356 residues (Full-length: 1-356)
Molecular Weight~39 kDa (predicted)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

The protein sequence begins with MSTIVQRQKEFNFFDLWDSFCA... and includes conserved regions critical for Q<sub>B</sub> binding and PSII assembly .

Expression and Purification

The gene psbA5 (locus Ava_4121) is cloned into prokaryotic vectors (e.g., pET28a) for heterologous expression in E. coli. Optimization strategies derived from related Anabaena proteins suggest:

ParameterOptimal Condition
Inducer (IPTG)0.5 mM
Temperature25°C
Induction Duration18 hours
Culture MediaTerrific Broth (TB) for high-density growth

Purification employs immobilized metal affinity chromatography (IMAC) via the His-tag, followed by size-exclusion chromatography .

Role in Photosystem II

  • psbA5 is a variant of the D1 protein, which forms the PSII reaction center. It binds cofactors (P680, pheophytin) and mediates electron transfer to Q<sub>B</sub> .

  • Under low-oxygen conditions, psbA genes in Anabaena are transcriptionally regulated, suggesting adaptive responses to environmental stress .

Applications and Research Use

  • Photosynthesis Studies: Used to investigate PSII assembly, electron transport mechanisms, and photodamage repair .

  • Biotechnology: Serves as a template for engineering stress-tolerant photosynthetic systems .

  • Therapeutic Potential: While not directly therapeutic, related Anabaena enzymes (e.g., phenylalanine ammonia-lyase) inform protein engineering for medical applications .

Limitations and Stability

  • Sensitivity: Repeated freeze-thaw cycles degrade activity; single-use aliquots are recommended .

  • Storage Buffer: Tris/PBS with trehalose enhances stability but requires reconstitution protocols to avoid aggregation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA6; Ava_4121; Photosystem II protein D1 4; PSII D1 protein 4; Photosystem II Q(B protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
psbA6
Target Protein Sequence
MSTIVQRQKEFNFFDLWDSFCAWITSTENRIYIGWFGVLSIPTLLAATTCFVLAFIAAPS VDMDGIREPIMGSLMDGNNLITAAVVPTSAAIGLHFYPIWEAASMDEWLYNGGPYQLIVL HFLIGIWCLLGRFWELSYRLGMRPWIAVAYSAPVIAATSVLLVYPIGQGSFSDGLPLGIA GTFHFMLAFQGDHNILMHPFHMLGVAGVFGGALLSSLHGSLVASTLIRNTDENESINGGY KLGQQQVTYKYLAGHNSFLGRLLIPTFASRNHRAFHFLLAALPTIGIWFAAMGVCSMAFN LNGLNFNHSILDSRGNVIRSDADILNRANIGLSVMHAPNVHNFPLVLSSGQPIPVS
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Anabaena variabilis Photosystem Q(B) protein 6 (psbA5)?

Photosystem Q(B) protein 6 (psbA5) is a critical component of the photosynthetic apparatus in Anabaena variabilis. This protein is part of the reaction center of Photosystem II (PSII), which participates in the light-dependent reactions of photosynthesis. The full-length protein consists of 356 amino acids and is available as a recombinant protein with a His-tag for research applications . While specific data on psbA5 is limited in the provided sources, it belongs to the broader family of photosystem proteins that are essential for photosynthetic function in cyanobacteria.

How does psbA5 differ from other photosystem proteins in Anabaena variabilis?

PsbA5 is part of the photosystem II (PSII) complex, which remains distinct from the photosystem I (PSI) proteins like PsaA and PsaB. Unlike PSI reaction center proteins that are encoded by the psaA and psaB genes, psbA5 forms part of a different photosynthetic complex with unique functional characteristics. Research on related photosystem components in Anabaena variabilis has shown that while mutations in psaA and psaB genes render cells unable to grow in light and lack PSI-mediated photochemical activity, their PSII complexes (including proteins like psbA5) remain fully active . This indicates the separate but complementary roles these protein complexes play in photosynthesis.

What expression systems are optimal for producing recombinant psbA5?

The most effective expression system for recombinant psbA5 protein production is Escherichia coli. Based on available information, recombinant full-length Anabaena variabilis Photosystem Q(B) Protein 6 can be successfully expressed in E. coli with a His-tag, yielding the complete 356 amino acid sequence . When designing an expression protocol, researchers should consider the following methodology:

  • Select an E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Use a vector with an inducible promoter (T7 or tac) and incorporate the His-tag for purification

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Implement a gentle cell lysis protocol to preserve protein structure

  • Use detergents appropriate for membrane protein solubilization

This approach allows for scalable production while maintaining protein integrity and function.

How can researchers effectively design mutation studies for psbA5?

When designing mutation studies for psbA5, researchers should apply the targeted mutagenesis approaches that have proven successful for other photosystem proteins in Anabaena variabilis. A methodological framework based on successful studies of related proteins would include:

  • Identify conserved domains through sequence alignment with homologous proteins

  • Design a construct for insertional inactivation of the psbA5 gene, similar to the approach used for psaA and psaB genes

  • Use a resistance cassette (such as neomycin-resistance) for selection

  • Implement double-crossover homologous recombination for precise genomic integration

  • Verify complete segregation of the mutated gene through colony PCR

  • Analyze phenotypic changes including pigmentation (chlorophyll/phycobilin ratio), photochemical activity, and growth characteristics

This methodological approach allows for systematic analysis of psbA5 function through strategic genetic modification.

How can researchers assess the impact of psbA5 mutations on photosynthetic efficiency?

Assessing the impact of psbA5 mutations requires a multi-parameter approach to photosynthetic function analysis. Based on methodologies employed in related photosystem protein studies, researchers should implement the following protocol:

  • Measure P680 reaction center chlorophyll content and photochemical activity

  • Quantify chlorophyll fluorescence parameters (F0, Fm, Fv/Fm) to assess PSII efficiency

  • Analyze oxygen evolution rates under various light intensities

  • Perform 77K fluorescence spectroscopy to evaluate energy transfer between photosystems

  • Measure the chlorophyll/PSII ratio, as mutations in photosystem proteins can significantly alter pigment composition

  • Assess growth rates under various light conditions

Data from these measurements should be compared between wild-type and mutant strains to comprehensively evaluate functional changes. The analysis should account for potential compensatory mechanisms that may mask direct effects of psbA5 mutations.

What methods are most effective for studying psbA5 interactions with other photosystem components?

To effectively study psbA5 interactions with other photosystem components, researchers should employ a combination of biochemical, biophysical, and genetic approaches:

  • Co-immunoprecipitation (Co-IP) with tagged psbA5 to identify interacting partners

  • Pull-down assays to confirm specific protein-protein interactions

  • Yeast two-hybrid screening for potential interaction partners

  • Cross-linking mass spectrometry to map interaction interfaces

  • Blue native gel electrophoresis to analyze intact complexes

  • Förster resonance energy transfer (FRET) analysis to study dynamics of interactions

These methodologies allow for comprehensive mapping of the psbA5 interactome within the photosynthetic apparatus, providing insights into its functional role in the larger PSII complex.

What structural features of psbA5 are critical for its function?

While specific structural data for Anabaena variabilis psbA5 is limited in the provided sources, researchers investigating critical structural features should focus on:

  • Transmembrane helices that anchor the protein in the thylakoid membrane

  • Quinone binding sites that facilitate electron transport

  • Conserved amino acid residues that coordinate with the manganese cluster

  • Regions involved in interactions with other PSII subunits

  • Domains responsible for binding cofactors (chlorophyll, carotenoids)

Understanding these structural elements requires comparative analysis with homologous proteins and application of structural prediction tools, combined with site-directed mutagenesis to validate functional hypotheses.

How do environmental factors affect psbA5 expression and function?

Environmental regulation of psbA5 can be studied in the context of Anabaena variabilis' ability to differentiate specialized cells under stress conditions. This cyanobacterium forms heterocysts under nitrogen limitation and akinetes (spore-like dormant cells) under other adverse conditions . To investigate environmental regulation of psbA5:

  • Monitor psbA5 expression under various stress conditions (nitrogen limitation, light intensity changes, temperature stress)

  • Compare expression patterns between vegetative cells, heterocysts, and akinetes

  • Analyze post-translational modifications that may occur under different environmental conditions

  • Assess protein turnover rates under varying light conditions

  • Evaluate the correlation between environmental stress responses and photosynthetic efficiency

This approach provides insights into how Anabaena variabilis regulates photosystem components, including psbA5, in response to environmental challenges.

How does psbA5 from Anabaena variabilis compare to homologs in other cyanobacteria?

Comparative analysis of psbA5 across cyanobacterial species reveals evolutionary patterns and functionally important conserved regions. Researchers should apply the following methodological approach:

  • Perform multiple sequence alignment of psbA5 homologs from diverse cyanobacteria

  • Identify highly conserved domains that suggest functional importance

  • Map known mutations and their phenotypic effects across species

  • Analyze selection pressure on different protein regions (dN/dS ratios)

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Compare expression patterns and regulation across species

This comparative approach provides evolutionary context for understanding psbA5 function and identifying regions of particular functional significance that have been preserved through selective pressure.

What can directed evolution approaches tell us about psbA5 function?

Directed evolution offers powerful insights into protein function through accelerated evolutionary processes. While not directly applied to psbA5 in the provided sources, methodologies from related studies on Anabaena variabilis proteins can be adapted:

  • Develop a high-throughput screening system that couples E. coli growth to psbA5 activity

  • Create a library of psbA5 variants through error-prone PCR or DNA shuffling

  • Implement selection conditions that favor improved variants

  • Analyze mutations in selected variants to identify functionally important residues

  • Characterize improved variants through biochemical and biophysical techniques

This approach has been successfully applied to other Anabaena variabilis proteins, such as phenylalanine ammonia-lyase (PAL), where directed evolution identified previously unknown mutations that increased turnover frequency nearly twofold after a single round of engineering .

How can researchers overcome challenges in functional reconstitution of psbA5?

Functional reconstitution of membrane proteins like psbA5 presents significant technical challenges. A methodological approach to overcome these challenges includes:

  • Optimize detergent selection for protein solubilization (test multiple classes: maltosides, glucosides, etc.)

  • Develop protocols for reconstitution into proteoliposomes or nanodiscs

  • Verify proper folding using circular dichroism and fluorescence spectroscopy

  • Assess functionality through electron transport measurements

  • Implement quality control steps to ensure homogeneity of reconstituted samples

  • Use complementary approaches (native membrane preparations vs. reconstituted systems)

This systematic approach helps overcome the inherent difficulties in working with membrane proteins while ensuring that functional data accurately reflects native protein behavior.

What approaches can resolve contradictions in psbA5 functional data?

Researchers encountering contradictory results in psbA5 studies should implement a structured troubleshooting methodology:

  • Standardize experimental conditions across laboratories (growth conditions, protein preparation methods)

  • Verify protein identity and purity through multiple techniques (mass spectrometry, SDS-PAGE, Western blotting)

  • Compare wild-type controls across experiments to establish baselines

  • Implement multiple, complementary assays to measure the same parameters

  • Validate findings in vivo and in vitro to identify context-dependent effects

  • Conduct collaborative cross-laboratory validation studies

This methodical approach helps identify sources of variability and resolves apparent contradictions in experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.