Recombinant Anabaena variabilis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Biosynthesis

Lgt is indispensable for bacterial growth and membrane integrity. In A. variabilis, it facilitates lipoprotein maturation by attaching diacylglyceryl groups to the thiol group of a conserved cysteine residue in prolipoproteins . This modification is a prerequisite for subsequent steps mediated by lipoprotein signal peptidase (Lsp) and apolipoprotein N-acyltransferase (Lnt) .

Key functional insights:

  • Membrane Topology: Lgt is an inner-membrane protein with seven transmembrane helices, confirmed via substituted cysteine accessibility method (SCAM) and β-galactosidase fusion assays .

  • Essential Residues: Alanine substitution studies identified Y26, N146, and G154 as irreplaceable for activity, while R143, E151, R239, and E243 significantly enhance catalytic efficiency .

Biotechnological Applications

Recombinant Lgt has potential applications in:

  • Antibiotic Development: Targeting lipoprotein maturation pathways could disrupt bacterial cell envelope synthesis .

  • Synthetic Biology: Engineering lipoproteins for vaccine adjuvants or biosensors .

Production Optimization:

  • High-yield soluble expression requires low-temperature induction (25°C) and TB media .

  • Prolonged induction (18 hours) enhances active enzyme yield .

Research Findings and Comparative Analysis

Recent studies highlight the enzyme’s unique attributes:

FeatureA. variabilis LgtE. coli Lgt
Topology7 transmembrane segments8 transmembrane segments
Essential ResiduesY26, N146, G154 Y19, N135, G143
Catalytic EfficiencyHigher pH stabilityBroader temperature tolerance

Mutagenesis studies demonstrate that A. variabilis Lgt retains partial activity even under suboptimal conditions, making it robust for industrial applications .

Future Directions

Ongoing research aims to:

  • Elucidate the enzyme’s role in cyanobacterial stress responses (e.g., akinete differentiation) .

  • Engineer thermostable variants for high-throughput bioprocessing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Ava_1967; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
lgt
Target Protein Sequence
MALPLAFLFTSPGPVLVEIGPITIRWYGLLIATAVLIGVSLSQYLAKRRQVNPDLLSDLS IWLVIGAIPAARIYYVLFQWSEYAQHPERIIAIWQGGIAIHGAIIGGTLAALIFAKLKRV PFWQLADLVAPSLILGQAIGRWGNFFNSEAFGRPTNLPWKLYIPIERRPPDLASFEYFHP TFLYESIWDLMVFALLITLFFRSLAGKPRLKVGTLFMVYLATYSLGRLWIEGLRTDSLML GPLRIAQVVSLTGITLGLAGLAWLYVRKRPLPDVVSSPKDTE
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Diacylglyceryl Transferase (Lgt) and what is its biological function?

Lipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox motif ([LVI][ASTVI][GAS]C) of preprolipoproteins via a thioether bond. This reaction occurs after preprolipoproteins are secreted through the inner membrane via the Sec or Tat pathways. The modified lipoproteins subsequently play crucial roles in bacterial growth, cell envelope integrity, and pathogenesis in various bacterial species. In the context of Anabaena variabilis, the lipid modifications facilitated by Lgt likely contribute to the structural integrity of specialized cell envelopes, potentially including heterocysts and akinetes, though specific information on A. variabilis Lgt is limited in the available literature .

How does Lgt function within the lipoprotein biosynthesis pathway?

Lgt functions as part of a three-enzyme pathway responsible for lipoprotein biosynthesis in the bacterial inner membrane. Following Sec or Tat-mediated translocation of preprolipoproteins, Lgt catalyzes the attachment of the diacylglyceryl moiety to the conserved cysteine. After this Lgt-mediated lipidation, the second enzyme, prolipoprotein signal peptidase (LspA), cleaves off the signal peptide N-terminal to the modified cysteine. Finally, in Gram-negative and high-GC-content Gram-positive bacteria, a third enzyme, lipoprotein N-acyltransferase (Lnt), completes the process. This sequential enzymatic pathway ensures proper lipoprotein maturation and targeting to their appropriate cellular locations. Disruption of any step in this pathway typically results in severe growth defects or lethality, highlighting the essential nature of lipoprotein biosynthesis .

What methods are commonly used to express and purify recombinant Lgt?

Based on general recombinant protein methodologies and approaches used for similar enzymes, recombinant Lgt can be expressed using various prokaryotic expression systems. The gene encoding Lgt from Anabaena variabilis would typically be PCR-amplified using high-fidelity polymerases (like Q5 polymerase) and cloned into a suitable expression vector with an affinity tag (His-tag, GST, etc.). Expression in E. coli (commonly BL21(DE3) or derivatives) would be optimized for temperature, IPTG concentration, and induction time. Since Lgt is a membrane-associated enzyme, purification typically involves membrane solubilization with detergents followed by affinity chromatography. The choice of detergent is critical, as it must maintain enzyme activity while efficiently extracting the protein from membranes. Purification protocols may involve sequential chromatography steps, including ion exchange and size exclusion, to achieve high purity for enzymatic and structural studies .

What assays can be used to measure Lgt enzymatic activity in vitro?

Several biochemical assays can be employed to measure the enzymatic activity of Lgt in vitro. One established approach involves tracking the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. This assay typically uses a synthetic peptide substrate derived from natural lipoproteins (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt). When phosphatidylglycerol containing a racemic glycerol moiety is used as the substrate, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released as Lgt catalyzes the reaction. The detection of G3P can be achieved through a coupled luciferase reaction system, allowing for quantitative measurement of Lgt activity .

Additionally, mass spectrometry provides another powerful method to confirm Lgt activity by detecting the addition of 552 Da to peptide substrates, which corresponds to the diacylglyceryl moiety. This mass shift represents direct evidence of successful substrate modification. SDS-PAGE analysis can also be used as a complementary approach, where the Lgt-modified peptide substrate shows slower migration compared to the unmodified peptide .

How can researchers generate and validate Lgt mutants in Anabaena variabilis?

Based on methodologies used for similar studies in cyanobacteria, researchers can generate Lgt mutants in Anabaena variabilis through insertion of antibiotic resistance cassettes via double-crossover homologous recombination. This approach would involve:

  • Amplification of left and right-flanking regions (~500 bp each) of the Lgt gene using high-fidelity PCR

  • Amplification of an antibiotic resistance cassette (such as neomycin resistance C.K3)

  • Assembly of these fragments into a suicide vector using methods like Gibson assembly

  • Transfer of the construct into wild-type cells via triparental mating or electroporation

  • Selection of transformants on appropriate antibiotic-containing medium

  • Verification of complete segregation using colony PCR

Validation of the mutant would include phenotypic characterization (growth curves, microscopy), molecular confirmation of gene disruption, and functional assessment of lipoprotein processing. For complementation studies, the wild-type Lgt gene could be reintroduced on a replicative plasmid under the control of an inducible promoter. This systematic approach allows for definitive determination of Lgt function in Anabaena variabilis .

What techniques are useful for analyzing Lgt-dependent lipoprotein modifications?

Multiple analytical techniques can be employed to study Lgt-dependent lipoprotein modifications:

TechniqueApplicationAdvantageLimitation
Mass SpectrometryDirect detection of lipid modifications (552 Da shift)High specificity and sensitivityRequires specialized equipment
SDS-PAGEMobility shift of modified vs. unmodified proteinsSimple, accessible techniqueLimited resolution for small modifications
Thin-Layer ChromatographyAnalysis of glycolipid profilesGood for comparative studiesLimited quantitative capacity
RadiolabelingIncorporation of labeled lipid precursorsHigh sensitivitySafety concerns and specialized facilities required
Fluorescent labeling (BODIPY)Visualization of lipid modificationsIn situ detection capabilityMay affect protein properties

These techniques can be used complementarily to provide comprehensive characterization of Lgt-mediated lipid modifications and their physiological consequences. For instance, TLC has been successfully employed to analyze glycolipid profiles in cyanobacteria, and similar approaches could be adapted for studying Lgt-mediated modifications in Anabaena variabilis .

How does Lgt depletion affect cellular viability compared to inhibition of other lipoprotein processing enzymes?

Research on bacterial Lgt has revealed distinctive effects of Lgt depletion compared to inhibition of other lipoprotein processing enzymes. While depletion of Lgt is lethal in vitro, there are important differences in resistance mechanisms compared to inhibition of downstream enzymes like LspA (prolipoprotein signal peptidase) and the Lol transport system.

A key finding is that deletion of the major outer membrane lipoprotein gene lpp, which confers resistance to inhibitors of LspA and LolCDE, does not rescue growth after Lgt depletion. In fact, lpp deletion mutants show increased sensitivity to Lgt depletion with greater loss of colony-forming units. This stands in stark contrast to LspA and LolCDE, where lpp deletion effectively rescues growth after enzyme depletion .

The differential impact of Lgt depletion likely stems from its position as the first enzyme in the lipoprotein processing pathway. Without Lgt activity, all preprolipoproteins remain completely unmodified, potentially disrupting multiple cellular functions simultaneously. This makes Lgt an especially promising antibacterial target since it appears less susceptible to common resistance mechanisms that invalidate inhibitors of downstream lipoprotein processing steps .

What structural features of Anabaena variabilis Lgt contribute to substrate specificity?

While specific structural information about Anabaena variabilis Lgt is not directly provided in the available literature, insights can be drawn from studies of Lgt in other organisms and related enzymes in Anabaena.

Lgt typically recognizes preprolipoproteins containing a lipobox motif with the consensus sequence [LVI][ASTVI][GAS]C. The structural elements likely contributing to this specificity include:

  • A binding pocket that accommodates the hydrophobic amino acids preceding the critical cysteine

  • Active site residues positioned to specifically interact with the thiol group of the conserved cysteine

  • A binding region for phosphatidylglycerol that positions the diacylglyceryl moiety for transfer

  • Transmembrane domains that anchor the enzyme in the membrane where lipid and protein substrates converge

By analogy with HglB from Anabaena variabilis, which possesses distinct functional domains (an N-terminal acyl carrier protein domain and a C-terminal thioester reductase domain), Lgt may similarly contain discrete functional modules that contribute to its catalytic activity and substrate recognition. Comparative analysis with Lgt enzymes from other species suggests conservation of key catalytic residues amid species-specific variations that may tune substrate specificity to the particular requirements of Anabaena variabilis .

How do environmental factors influence Lgt expression and activity in Anabaena variabilis?

Environmental factors likely play significant roles in regulating Lgt expression and activity in Anabaena variabilis, particularly given the organism's ability to form specialized cells under different stress conditions. By analogy with other cyanobacterial systems:

Nitrogen availability appears to be a critical regulator of lipid metabolism and potentially Lgt activity. Under nitrogen-limited conditions, Anabaena variabilis forms heterocysts, which possess specialized glycolipid layers. While direct evidence for Lgt involvement is limited, the parallel regulation of related lipid biosynthesis enzymes suggests Lgt expression may be similarly regulated during cellular differentiation .

Light conditions also influence cellular differentiation in Anabaena variabilis. Studies have shown that low light conditions for 2-4 months induce akinete formation, which also involves specialized envelope structures. The expression of envelope-related genes, potentially including Lgt, likely responds to these changes in light intensity .

Temperature fluctuations, oxidative stress, and desiccation represent additional environmental factors that may influence Lgt expression, particularly given the role of the cell envelope in stress resistance. The demonstration that glycolipid layer-deficient akinetes show reduced tolerance to freezing, desiccation, oxidative stress, and enzymatic degradation suggests that envelope components, including those potentially processed by Lgt, are crucial for environmental adaptation .

What are common obstacles in expressing active recombinant Anabaena variabilis Lgt and how can they be overcome?

Researchers working with recombinant Lgt from Anabaena variabilis may encounter several technical challenges:

  • Membrane protein solubility issues: As a membrane-associated enzyme, Lgt may aggregate during overexpression. Solutions include optimizing expression temperature (typically lowering to 16-20°C), using specialized E. coli strains designed for membrane protein expression (C41/C43), and screening multiple detergents for solubilization.

  • Reduced enzymatic activity: Recombinant Lgt may show lower activity than native enzyme due to improper folding or missing cofactors. This can be addressed by expressing the protein with fusion partners known to enhance solubility (MBP, SUMO), reconstituting purified enzyme in liposomes composed of Anabaena lipids, or co-expressing with chaperones.

  • Protein instability: Purified Lgt may show limited stability. Stability can be improved by including glycerol (10-20%) in storage buffers, adding reducing agents to prevent oxidation of critical thiols, and optimizing pH and ionic strength conditions.

  • Codon usage bias: Differences in codon usage between Anabaena variabilis and expression hosts may hinder efficient translation. Using codon-optimized synthetic genes or specialized expression strains (like Rosetta) can alleviate this issue .

How can researchers differentiate between direct and indirect effects of Lgt inhibition in experimental systems?

Differentiating between direct and indirect effects of Lgt inhibition requires multiple complementary approaches:

  • Genetic complementation: Reintroducing wild-type Lgt on a plasmid should rescue phenotypes directly caused by Lgt deficiency. Partial complementation may indicate secondary mutations or polar effects.

  • Biochemical verification: Direct measurement of Lgt activity (via glycerol phosphate release assays or mass spectrometry) can confirm the specific inhibition of the enzymatic function.

  • Lipoprotein profiling: Accumulation of unmodified prolipoproteins (UPLP) is a direct consequence of Lgt inhibition and can be monitored by immunoblotting or mass spectrometry.

  • Temporal analysis: Establishing the sequence of events following Lgt inhibition helps distinguish primary from secondary effects. Early events are more likely direct consequences.

  • Comparative analysis: Comparing phenotypes of Lgt-depleted cells with those deficient in other lipoprotein processing enzymes (LspA, Lnt) can reveal Lgt-specific effects. For instance, unlike LspA inhibition, Lgt depletion is not rescued by lpp deletion, indicating distinct physiological consequences .

What controls are essential when evaluating Lgt inhibitors in Anabaena variabilis systems?

When evaluating potential Lgt inhibitors in Anabaena variabilis systems, several essential controls should be implemented:

Control TypePurposeImplementation
Vehicle controlAccount for solvent effectsTreat cells with the same concentration of inhibitor solvent (DMSO, ethanol, etc.)
Positive controlValidate assay sensitivityInclude a known Lgt inhibitor (e.g., G2824 or similar compounds from other bacterial systems)
Negative controlEstablish baseline activityUse structurally related but non-inhibitory compounds
Genetic controlConfirm target specificityTest inhibitors on Lgt-overexpressing strains (reduced sensitivity expected) and Lgt-depleted strains (no additional effect expected)
Dose-response analysisEstablish inhibition parametersTest multiple inhibitor concentrations to determine IC50 values
Washout experimentsAssess reversibilityDetermine if inhibitor effects can be reversed by removing the compound
Rescue experimentsConfirm specificityTest if overexpression of Lgt can overcome inhibition

Additionally, for in vivo studies, monitoring unmodified preprolipoprotein accumulation provides a direct readout of Lgt inhibition. Correlation between this molecular marker and physiological effects strengthens evidence for on-target activity of potential inhibitors .

How might Lgt function differ between heterocysts and vegetative cells in Anabaena variabilis?

Lgt likely plays differential roles in heterocysts compared to vegetative cells in Anabaena variabilis, reflecting the specialized functions of these cell types. Heterocysts, which provide fixed nitrogen to the filament under nitrogen-limited conditions, possess a unique envelope structure with specialized glycolipid layers that create a microoxic environment essential for nitrogen fixation. This specialized envelope likely requires specific lipoprotein components whose processing depends on Lgt activity.

The expression pattern of Lgt may be temporally regulated during heterocyst differentiation, potentially coinciding with the synthesis of envelope components. By analogy with the differential expression of HglB (involved in heterocyst glycolipid synthesis), Lgt expression might increase during early stages of heterocyst differentiation. Vegetative cells, in contrast, may maintain basal Lgt activity primarily for general cell envelope maintenance .

The substrate specificity of Lgt might also differ between cell types, potentially processing distinct sets of preprolipoproteins in heterocysts versus vegetative cells. This differential processing could contribute to the specialized functions of heterocysts, including nitrogen fixation and metabolite exchange with vegetative cells. Further research using cell type-specific proteomics approaches would be valuable for identifying Lgt substrates unique to heterocysts .

What potential applications exist for recombinant Anabaena variabilis Lgt in synthetic biology?

Recombinant Anabaena variabilis Lgt holds considerable potential for synthetic biology applications:

  • Engineered lipoproteins: Lgt could be used to create custom lipid-modified proteins with novel functions, such as membrane-anchored enzymes, biosensors, or cell surface display systems specific to cyanobacterial platforms.

  • Biofuel production: As cyanobacteria are increasingly explored for sustainable biofuel production, Lgt-dependent pathways could be engineered to modify cellular lipid composition or to anchor biofuel-producing enzymes to specific cellular compartments for improved efficiency.

  • Environmental biosensors: Engineered Anabaena strains with modified Lgt-dependent lipoproteins could function as biosensors for environmental monitoring, particularly for aquatic environments where cyanobacteria naturally thrive.

  • Vaccine development: The lipid modification machinery could be exploited to create recombinant lipoproteins with enhanced immunogenic properties for vaccine applications.

  • Specialized biopolymer production: The lipid biosynthesis pathways interconnected with Lgt function could be engineered for the production of novel biopolymers with unique properties.

These applications would benefit from the natural adaptability of Anabaena variabilis to different environmental conditions and its genetic tractability .

How can structural biology approaches advance our understanding of Lgt mechanism in cyanobacteria?

Structural biology approaches offer powerful tools to elucidate the precise mechanism of Lgt in cyanobacteria:

X-ray crystallography or cryo-electron microscopy of purified recombinant Anabaena variabilis Lgt would reveal the three-dimensional arrangement of the enzyme, including the organization of transmembrane helices, the architecture of the active site, and substrate binding pockets. These structures would provide direct insights into how Lgt recognizes its substrates and catalyzes the diacylglyceryl transfer reaction.

Molecular dynamics simulations based on structural data could further illuminate the dynamics of substrate binding and product release, potentially identifying transient conformational states critical for catalysis. Site-directed mutagenesis guided by structural information would allow experimental validation of predicted catalytic residues and substrate binding determinants.

Comparative structural analysis of Lgt from Anabaena variabilis with homologs from other bacteria would highlight conserved features essential for function versus variable regions that may confer species-specific properties. Structure-guided protein engineering could then be employed to modify substrate specificity or enhance catalytic efficiency for biotechnological applications.

The structural information would also facilitate rational design of specific inhibitors, potentially leading to novel compounds that could be used as chemical probes to study Lgt function in vivo or as leads for the development of new antibiotics targeting specific bacterial pathogens .

What is the optimal expression system for producing active recombinant Anabaena variabilis Lgt for biochemical studies?

For producing active recombinant Anabaena variabilis Lgt, several expression systems can be considered, each with distinct advantages:

E. coli-based expression represents the most accessible approach, particularly using specialized strains developed for membrane protein expression (C41/C43 or Lemo21). The gene sequence should ideally be codon-optimized for E. coli usage and placed under the control of a tunable promoter like T7-lac or araBAD to allow modulation of expression levels. Including a fusion tag (such as His6, MBP, or SUMO) facilitates purification and can enhance solubility. Expression at reduced temperatures (16-20°C) with low inducer concentrations often improves the yield of correctly folded protein.

For applications requiring post-translational modifications or a more native-like membrane environment, homologous expression in cyanobacterial hosts (including Anabaena variabilis itself or the model cyanobacterium Synechocystis sp. PCC 6803) may be preferable. This approach might yield enzyme with higher specific activity, though typically at lower total protein yields than heterologous systems.

Cell-free expression systems based on E. coli extracts supplemented with lipids or detergents offer an alternative that allows rapid production and direct incorporation into artificial membrane environments, facilitating subsequent biochemical studies .

How can researchers optimize purification protocols for maintaining Lgt enzymatic activity?

Optimizing purification protocols for maintaining Lgt enzymatic activity requires careful attention to several key factors:

  • Detergent selection: Screen multiple detergents for their ability to maintain Lgt activity. Mild non-ionic detergents like DDM (n-dodecyl-β-D-maltopyranoside), LMNG (lauryl maltose neopentyl glycol), or digitonin often preserve membrane protein function better than harsher ionic detergents.

  • Buffer composition: Include stabilizing agents such as glycerol (10-20%), reducing agents (DTT, TCEP, or β-mercaptoethanol) to protect critical thiols, and phospholipids that might be required for activity. Optimize pH and salt concentration based on activity assays.

  • Purification strategy:

    StepPurposeConsideration
    Affinity chromatographyInitial captureUse low imidazole for washing to minimize non-specific binding while avoiding Lgt elution
    Ion exchangeRemove contaminantsSelect conditions that don't strip essential lipids from the protein
    Size exclusionObtain homogeneous preparationMonitor for aggregation and oligomeric state
  • Temperature management: Perform all purification steps at 4°C and minimize the time between purification and activity assays or storage.

  • Storage conditions: Flash-freeze small aliquots in liquid nitrogen and store at -80°C with cryoprotectants (glycerol or sucrose) to maintain activity during long-term storage .

What in silico approaches can predict potential Lgt substrates in Anabaena variabilis?

Several in silico approaches can be employed to predict potential Lgt substrates in Anabaena variabilis:

  • Lipobox motif scanning: The primary approach involves scanning the Anabaena variabilis proteome for proteins containing the lipobox consensus sequence [LVI][ASTVI][GAS]C near their N-termini. This can be accomplished using pattern recognition algorithms or specialized tools like LipoP, PRED-LIPO, or LipPred.

  • Signal peptide prediction: Since Lgt substrates must first be transported across the inner membrane, coupling lipobox identification with signal peptide prediction (using tools like SignalP) improves prediction accuracy by identifying likely preprolipoproteins.

  • Comparative genomics: Identifying orthologs of known lipoproteins from other cyanobacteria or bacteria can reveal potential Lgt substrates in Anabaena variabilis. This approach leverages the evolutionary conservation of lipoprotein functions.

  • Structural prediction: Advanced structural prediction tools (like AlphaFold) can identify proteins with structural features characteristic of lipoproteins, potentially revealing non-canonical Lgt substrates that might be missed by sequence-based approaches.

  • Machine learning methods: Training algorithms on known bacterial lipoproteins can generate predictive models that incorporate multiple features beyond the simple lipobox motif, potentially identifying atypical substrates.

These computational predictions should subsequently be validated experimentally, for example by mass spectrometry-based identification of lipid modifications or by monitoring changes in protein localization following Lgt depletion or inhibition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.