Recombinant Anabaena variabilis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Anabaena variabilis Protease HtpX homolog (htpX) is a full-length, His-tagged protein (UniProt ID: Q3MH22) expressed in Escherichia coli. It consists of 289 amino acids (MW: ~33 kDa) and is purified to >90% purity via affinity chromatography . Key features include:

PropertyDetail
Source OrganismAnabaena variabilis (strain ATCC 29413 / PCC 7937)
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid freeze-thaw cycles

Biochemical Properties

Key functional attributes include:

ParameterSpecification
ActivityDegrades β-casein; inhibited by EDTA
Optimal pHNot explicitly stated, but storage buffer pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water; add glycerol
Purity>90% (SDS-PAGE)

Functional Roles

HtpX homologs are implicated in:

  • Membrane protein quality control: Complements ATP-dependent proteases like FtsH in degrading misfolded membrane proteins .

  • Regulated intramembrane proteolysis (RIP): Cleaves transmembrane segments of substrates to release transcription factors or signaling molecules .

  • Stress adaptation: Likely involved in Anabaena’s differentiation processes (e.g., heterocyst formation) .

Protease Activity and Mechanism

  • Mutagenesis of the HEXXH motif (e.g., E192Q) abolishes activity, confirming metalloprotease dependence on zinc coordination .

  • Cleaves artificial substrates (e.g., pro-σK) at specific glycine-tyrosine bonds, analogous to Bacillus subtilis SpoIVFB .

Localization and Expression

  • Homologs in E. coli and B. subtilis are plasma membrane-integrated with cytosolic active sites .

  • In Anabaena, HtpX-related proteases are linked to nitrogen fixation and stress responses .

Applications

  • Membrane protease studies: Used to investigate RIP mechanisms in cyanobacteria .

  • Enzymatic assays: Serves as a model for zinc metalloprotease kinetics and inhibition .

  • Biotechnology: Potential tool for engineered protein degradation systems.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in the order notes and we will fulfill your preference whenever possible.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For specific delivery information, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. To reconstitute the protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While we determine the tag type during production, we are open to fulfilling specific tag requests. Please inform us of your desired tag type, and we will prioritize its implementation whenever possible.
Synonyms
htpX; Ava_0088; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
htpX
Target Protein Sequence
MGNQFKTLALLAALSGLLIAISYWVIGGSSGLIIGIGLAAVTNLLSWYQSDKIALAVYRA QPVSESQAPRLYRMVQRLSQRANIPMPGVYIVPGQTANAFATGRDPEHAAVAVTEGILNI LPEDELEAVIAHELTHIINRDTLTQAVAATVAGAISFLAQMVSYSLWFGGIGGRDNERGG NPLGVLLTVVLAPIAATIIQLAISRTREFSADAGSARLTGNPRALARALQRLEAAARQIP LNANPAFEPLLIINSISGQFLGNLFSSHPSTEARVQALLKLEKQLPTIA
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.