Recombinant Anabaena variabilis Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Anabaena variabilis PcxA

The pcxA gene encodes the Proton Extrusion Protein PcxA, which facilitates proton transport across cellular membranes. Recombinant versions are produced to study its structure-function relationships and potential applications in bioenergy and stress response research. Key features include:

  • Gene locus: Ava_1182 in Anabaena variabilis (strain ATCC 29413 / PCC 7937) .

  • UniProt ID: Q3MDY0 .

  • Protein length: 467 amino acids (aa) in A. variabilis , compared to 461 aa in the homologous protein from Thermosynechococcus elongatus .

Recombinant Expression and Purification

Recombinant PcxA is typically expressed in E. coli systems due to their scalability and cost-effectiveness. Key protocols include:

  • Induction: Optimized IPTG concentrations (0.5 mM) and low-temperature cultivation (25°C) to enhance soluble expression .

  • Purification: Affinity chromatography (e.g., His-tag systems) followed by buffer exchange into glycerol-containing solutions for stability .

  • Yield: ~50 µg per batch for A. variabilis PcxA , with higher yields reported for homologs like T. elongatus PcxA .

Role in Cellular Physiology

  • Proton extrusion: PcxA contributes to pH homeostasis by exporting excess protons, particularly under nitrogen-limited conditions .

  • Stress adaptation: Linked to akinete (spore-like cell) formation in A. variabilis, where glycolipid layers—dependent on proton gradients—enhance stress tolerance .

Enzymatic Activity

  • ATP-binding capacity: Demonstrated through biochemical assays, suggesting energy-dependent proton transport .

  • Biotin carboxylase interaction: Indirectly supports fatty acid synthesis pathways via proton motive force regulation .

Applications in Biotechnology

  • Bioenergy research: Engineered PcxA variants are explored for enhancing photosynthetic efficiency in cyanobacterial biofuel production .

  • Therapeutic development: While not directly therapeutic, recombinant expression techniques for PcxA parallel those used for PEGylated enzymes like phenylalanine ammonia-lyase (PAL), which treats phenylketonuria .

Challenges and Future Directions

  • Stability issues: Recombinant PcxA degrades rapidly without glycerol or trehalose stabilizers .

  • Structural elucidation: No full crystallographic data exists yet; resolving this could aid in rational engineering .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pcxA; cemA; Ava_1182; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Target Names
pcxA
Target Protein Sequence
MPTMRNSIFSEKVYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSTVILEKL KFIDEIISKYIITDYEIAAPSGASDLQVRTTSLQPPENPSLTDSLRNNDINKNNLVERIY TPTSPPQLIRPRTEQNKKPRGKADTTGILPRSILSTIGRLQIELDPNSEQDVINNFRQAQ KRSIISIRFILLLIIVPLLTHQLSKALIVSPIFNHFKKADTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEEIAAEFRGESANAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE
Uniprot No.

Target Background

Function
Involved in light-induced Na⁺-dependent proton extrusion and potentially CO₂ transport.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for recombinant expression of PcxA in Escherichia coli?

Based on studies with other cyanobacterial proteins from Anabaena variabilis, the following expression conditions are recommended:

Expression vector selection:

  • pET28a expression vector has been successfully used for expression of Anabaena variabilis proteins

  • Consider vectors with N-terminal or C-terminal His-tags to facilitate purification

Culture conditions:

  • TB (Terrific Broth) medium typically yields higher protein expression than LB medium

  • Growth temperature: 25°C shows higher yields of soluble protein compared to higher temperatures

  • Induction: 0.5 mM IPTG has been found optimal for related Anabaena proteins

  • Shaking speed: 150 rpm provides optimal aeration

  • Induction period: 18 hours has been shown to maximize protein yield

ParameterOptimal ConditionEffect on Protein Yield
MediumTB (Terrific Broth)Higher yield compared to LB
Temperature25°CMaximizes soluble protein fraction
IPTG concentration0.5 mMBalances expression rate and toxicity
Shaking speed150 rpmProvides optimal aeration
Induction time18 hoursAllows maximum accumulation

How can codon optimization improve PcxA expression in heterologous hosts?

Codon optimization can significantly improve the expression of cyanobacterial proteins in E. coli by addressing several key factors:

  • Codon usage bias: Optimizing codons to match the host's preferred codons can enhance translation efficiency. Recent research indicates that beyond the traditional Codon Adaptation Index (CAI), considering codon influence on host fitness (χ value) can yield better results for protein production .

  • GC content modulation: Anabaena variabilis has different GC content compared to E. coli, which can affect mRNA secondary structure and stability. Adjusting GC content while maintaining amino acid sequence can improve expression.

  • Removal of rare codons: Eliminating rare codons in the host organism prevents ribosomal stalling during translation.

  • Elimination of mRNA secondary structures: Removing sequences that form stable mRNA secondary structures, particularly near the start codon, improves translation initiation.

Methodology for codon optimization:

  • Use algorithms that balance multiple parameters (CAI, GC content, χ values)

  • Test multiple codon-optimized variants experimentally

  • Consider Principal Component Analysis (PCA) to evaluate the sequence variation in codon-optimized constructs

What are the most effective assays for measuring PcxA activity?

As a proton extrusion protein, PcxA activity can be measured using several complementary approaches:

  • pH-sensitive fluorescent probes:

    • Use pH-sensitive fluorophores like BCECF or pHrodo to monitor intracellular pH changes

    • Methodology includes loading cells with the probe, then measuring fluorescence changes during stimulation

    • Data can be collected using fluorescence microscopy or plate reader formats

  • Proton flux measurements:

    • Use a pH electrode to measure extracellular pH changes in real-time

    • Self-referencing ion-selective electrodes can provide spatial information about proton fluxes

  • Membrane vesicle assays:

    • Prepare inside-out membrane vesicles containing recombinant PcxA

    • Monitor proton movement across vesicle membranes using pH-sensitive dyes or electrochemical techniques

  • Electrophysiological techniques:

    • Patch-clamp recordings can measure proton currents across membranes expressing PcxA

    • Planar lipid bilayer reconstitution with purified PcxA allows direct measurement of transport activity

How can directed evolution be applied to enhance PcxA functions?

Directed evolution is a powerful approach for engineering proteins with enhanced or novel functions. For PcxA, this methodology can be adapted from approaches used with other Anabaena variabilis proteins:

  • Library generation strategies:

    • Error-prone PCR with controlled mutation rates (0.5-5 mutations per gene)

    • DNA shuffling of homologous pcxA genes from different cyanobacterial species

    • Site-saturation mutagenesis targeting predicted functional residues

  • High-throughput screening methods:

    • Develop a system coupling PcxA activity to cellular growth, similar to approaches used for other Anabaena proteins

    • Use pH-sensitive fluorescent proteins as reporters for PcxA activity

    • Implement microfluidic sorting based on proton transport activity

  • Iterative improvement:

    • Perform multiple rounds of selection, typically 3-5 generations

    • Sequence beneficial mutants after each round to identify mutational hotspots

    • Combine beneficial mutations through site-directed mutagenesis

A successful directed evolution strategy requires careful design of the selection pressure to specifically target the desired functional improvement in PcxA.

What approaches are most effective for studying PcxA membrane topology?

Understanding the membrane topology of PcxA is crucial for elucidating its function. Several complementary methods can be employed:

  • Computational prediction:

    • Use multiple topology prediction algorithms (TMHMM, HMMTOP, MEMSAT)

    • Hydrophobicity analysis to identify potential transmembrane segments

    • Consensus prediction from multiple tools improves accuracy

  • Experimental validation:

    • Cysteine scanning mutagenesis combined with accessibility assays

    • Epitope insertion at predicted loops followed by antibody accessibility tests

    • Protease protection assays to determine exposed regions

  • Advanced structural methods:

    • Cryo-electron microscopy for structural determination

    • Site-directed spin labeling combined with EPR spectroscopy

    • Cross-linking studies to identify proximities between domains

  • Reporter fusion approach:

    • Create fusions with reporter proteins (GFP, alkaline phosphatase, β-lactamase)

    • Position reporters at predicted loop regions

    • Activity/fluorescence indicates cellular localization of the fusion point

How can exoproteome analysis inform studies of PcxA function?

Exoproteome analysis, which examines proteins in the extracellular space, can provide valuable insights into PcxA function:

  • Methodology for exoproteome isolation:

    • Careful separation of cells from growth medium to avoid contamination with cellular proteins

    • Concentration of extracellular proteins using ultrafiltration or precipitation

    • Protein identification using LC-MS/MS and database searching

  • Comparative exoproteome analysis:

    • Compare exoproteomes under different growth conditions (nitrogen sources, pH, light intensity)

    • Analyze differences between wild-type and pcxA mutant strains

    • Identify proteins whose extracellular abundance is affected by PcxA function

  • Functional connections:

    • Look for patterns in co-regulation of PcxA and other extracellular proteins

    • Identify potential protein-protein interactions involving PcxA

    • Examine if PcxA influences the secretion or activity of extracellular enzymes

The Anabaena sp. PCC 7120 exoproteome has been characterized and contains 139 proteins across 16 functional categories , providing a reference for studying related cyanobacteria like Anabaena variabilis.

How does PcxA contribute to pH homeostasis in Anabaena variabilis?

PcxA likely plays a crucial role in pH homeostasis in Anabaena variabilis, though specific mechanisms need further investigation. Research approaches should include:

  • pH stress experiments:

    • Compare wild-type and pcxA deletion mutants under pH stress conditions

    • Monitor internal pH using ratiometric fluorescent probes

    • Measure growth rates and physiological parameters at different pH values

  • Transcriptional regulation studies:

    • Analyze pcxA expression under different pH conditions using RT-qPCR

    • Identify transcription factors that regulate pcxA expression

    • Map the promoter region to identify pH-responsive elements

  • Metabolic impact assessment:

    • Use metabolomics to identify metabolic changes in pcxA mutants

    • Monitor photosynthetic and respiratory activities under pH stress

    • Measure intracellular ion concentrations (H+, Na+, K+) to understand compensatory mechanisms

  • Protein interaction network:

    • Identify proteins that interact with PcxA using pull-down assays or yeast two-hybrid screening

    • Characterize protein complexes containing PcxA using blue native PAGE

    • Determine if PcxA works in concert with other transporters or pH sensors

How can Principal Component Analysis (PCA) be applied to analyze experimental data related to PcxA function?

Principal Component Analysis (PCA) is a powerful statistical technique for analyzing complex datasets in PcxA research:

  • Application to transcriptomic data:

    • Use PCA to identify patterns in gene expression data from experiments comparing wild-type and pcxA mutants

    • Reduce dimensionality while preserving relationships between genes

    • Identify co-regulated genes that may function in the same pathway as PcxA

  • Metabolomic data analysis:

    • Apply PCA to metabolite profiles to identify metabolic shifts associated with pcxA mutation

    • Reduce hundreds of metabolite variables to a few principal components

    • Visualize metabolic responses to different experimental conditions

  • Structure-function relationship analysis:

    • Use PCA to analyze the relationship between mutations in pcxA and functional outcomes

    • Identify which structural features contribute most to functional variation

    • Guide rational design of PcxA variants with desired properties

  • Methodology for effective PCA:

    • Properly scale and normalize data before analysis

    • Select appropriate number of principal components based on variance explained

    • Interpret loading plots to understand which variables contribute to each principal component

    • Validate findings using independent statistical methods

PCA reduces dimensionality while preserving as much variability as possible, making it ideal for analyzing the multivariate datasets typically generated in PcxA research .

What strategies are effective for creating pcxA knockout mutants in Anabaena variabilis?

Creating genetic knockouts in cyanobacteria presents unique challenges due to their polyploidy and the essential nature of many genes. For pcxA, consider the following approaches:

  • Homologous recombination strategy:

    • Design constructs with antibiotic resistance cassettes flanked by pcxA homologous regions

    • Transform cells using natural transformation, electroporation, or conjugation from E. coli

    • Select transformants on antibiotic plates and confirm recombination by PCR

  • Complete segregation verification:

    • Multiple rounds of selection may be required to achieve complete segregation

    • Use PCR with primers flanking the insertion site to verify absence of wild-type copies

    • Perform Southern blot analysis to confirm complete replacement of all genome copies

  • Conditional knockout approaches:

    • If pcxA is essential, consider using inducible promoters to control expression

    • Alternatively, create merodiploid strains where a second copy under an inducible promoter enables viability

  • CRISPR-Cas9 approaches:

    • Design guide RNAs targeting pcxA

    • Include homology-directed repair templates to introduce desired mutations

    • Screen transformants for successful editing using sequencing

Research on other Anabaena variabilis genes suggests that some genes may be essential, as attempts to completely segregate mutants can be unsuccessful, indicating the gene's importance for viability .

How can RNA-seq data be analyzed to understand the impact of pcxA mutation?

RNA sequencing provides comprehensive transcriptome information to understand the cellular impact of pcxA mutation:

  • Experimental design considerations:

    • Include biological replicates (minimum 3) for statistical power

    • Consider multiple growth conditions to identify condition-specific effects

    • Include appropriate controls (wild-type, complemented mutant)

  • Data analysis pipeline:

    • Quality control and trimming of raw reads

    • Mapping to Anabaena variabilis genome (ATCC 29413 / PCC 7937)

    • Differential expression analysis using DESeq2 or edgeR

    • Pathway enrichment analysis to identify affected cellular processes

  • Advanced analytical approaches:

    • Co-expression network analysis to identify genes functionally related to pcxA

    • Principal Component Analysis to visualize global transcriptional changes

    • Time-course analysis to understand dynamic responses to pcxA mutation

  • Validation strategies:

    • Confirm key findings using RT-qPCR

    • Correlate transcriptomic changes with physiological or biochemical measurements

    • Test predictions using additional genetic manipulations

This comprehensive RNA-seq approach will reveal how PcxA influences global gene expression patterns and identify cellular processes most affected by its absence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.