Recombinant Anaerocellum thermophilum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Anaerocellum thermophilum Lipoprotein Signal Peptidase (LspA)

Recombinant Anaerocellum thermophilum Lipoprotein signal peptidase (LspA) is a partially produced protein in Yeast . Lipoprotein signal peptidase (LspA) is derived from Anaerocellum thermophilum, a strictly anaerobic bacterium that thrives at 75°C . A. thermophilum is known for its ability to degrade a variety of polysaccharides, including crystalline cellulose and untreated plant biomass, showing its potential in biomass conversion .

Biological Characteristics of Anaerocellum thermophilum

Anaerocellum thermophilum is a thermophilic, cellulolytic, anaerobic bacterium . It was initially isolated from a hot spring and identified as strain Z-1320 . This strain was deposited in the German Collection of Microorganisms and Cell Cultures (DSMZ) as DSM 6725 . A. thermophilum can grow at temperatures up to 90 degrees C (pH 7.2) and effectively degrades crystalline cellulose, xylan, and untreated plant biomass, including potential feedstocks for bioenergy production . The predominant end products from all growth substrates are hydrogen, acetate, and lactate .

Genomic Information

The complete genome sequence of Anaerocellum thermophilum DSM 6725 consists of 2.97 Mb, which includes one chromosome and two plasmids . The chromosome has 35.17% GC, while the plasmids pATHE01 and pATHE02 have 38.53% and 42.92% GC, respectively . The genome contains approximately 2,662 coding sequences, three rRNA operons, and 47 tRNA genes . Genes are organized into 573 multigene transcripts and 626 single-gene transcripts, with 102 transcripts involved in the degradation of complex polysaccharides .

LspA Production and Availability

Recombinant Anaerocellum thermophilum Lipoprotein signal peptidase (LspA) is available for purchase from certain vendors . It can be produced in various expression systems, including Yeast, E. coli, Baculovirus, and Mammalian cells .

Applications and Research Significance

  • Biomass Degradation: A. thermophilum is capable of efficiently degrading lignocellulosic plant biomass without pretreatment, making it valuable for bioenergy research .

  • Enzyme Production: The bacterium produces a broad set of cellulolytic enzymes, transporters, and pathways for sugar utilization .

  • Genetic Studies: The complete genome sequence allows for comparative genomic studies with other saccharolytic, anaerobic thermophiles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Athe_1371; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) (Anaerocellum thermophilum)
Target Names
lspA
Target Protein Sequence
MVYWIIIMSTFVLDQLTKARAEKFFVDSPVNLLGGILSLTYVQNRGGAFSILEGKRRFFI IVSIILILFLCYMIFKSTSNLYKFSFSLIVGGAIGNLFDRIVKGYVVDFIDIKVIPVFNL ADFFITGGVLLLTFLILKEGGEELFLKKKP
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Anaerocellum thermophilum Lipoprotein signal peptidase (lspA)?

Lipoprotein signal peptidase (lspA) from Anaerocellum thermophilum is a specialized enzyme that belongs to the class of aspartic peptidases. It plays a crucial role in the maturation of bacterial lipoproteins by removing the signal peptide after lipidation of the target cysteine residue by lipoprotein diacylglyceryl transferase (Lgt). The enzyme is characterized by four predicted transmembrane-spanning regions and five conserved sequence regions that have been identified through comparative analysis . The lspA from A. thermophilum (strain DSM 6725 / Z-1320) is encoded by the gene lspA (Ordered Locus Name: Athe_1371) and functions as an essential component of the bacterial lipoprotein processing machinery .

It should be noted that Anaerocellum thermophilum has been reclassified, with strain DSM 6725 now falling within the Caldicellulosiruptor clade based on recent phylogenetic and genome sequence analyses . This taxonomic update is important for researchers working with this organism to ensure accurate attribution in scientific publications.

How does lspA function in bacterial lipoprotein processing?

Lipoprotein signal peptidase operates as part of a sequential processing pathway for bacterial lipoproteins. The process begins with the synthesis of pre-prolipoproteins containing specialized signal peptides with a lipobox motif (consensus sequence LxxC) at the carboxyl region . This motif directs the protein to the correct posttranslational processing pathway.

The processing occurs in the following sequential steps:

  • The pre-prolipoprotein is translocated across the cytoplasmic membrane with its signal peptide anchoring it to the membrane.

  • Lipoprotein diacylglyceryl transferase (Lgt) catalyzes the attachment of a diacylglyceryl group to the thiol group of the conserved cysteine residue in the lipobox.

  • This lipidation is considered a prerequisite for lspA action.

  • LspA then cleaves the signal peptide, leaving the lipidated cysteine as the new amino-terminal residue of the mature lipoprotein .

The cleavage specificity appears to be dependent on the recognition of the diacylglyceryl-modified cysteine residue in the lipobox of preproteins, with several highly conserved residues stabilizing the active site and/or participating in substrate recognition .

What are the optimal conditions for expressing recombinant A. thermophilum lspA in E. coli?

While the search results don't provide specific conditions for A. thermophilum lspA expression, we can derive methodological insights from experimental design approaches used for other recombinant proteins in E. coli. A systematic approach using factorial design can be applied to optimize expression conditions:

ParameterRecommended RangeOptimization Approach
Induction OD6000.6-0.8Start induction at OD600 0.8 for higher cell density
IPTG Concentration0.1-1.0 mMBegin with 0.1 mM IPTG to reduce inclusion body formation
Temperature25-37°CLower temperature (25°C) promotes soluble expression
Induction Time4-6 hours4 hours for optimal productivity per unit time
Media CompositionVariesBalanced media with 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

Researchers should implement a 2^n factorial design to thoroughly evaluate these parameters and their interactions. This multivariant approach allows for the estimation of statistically significant variables while considering interactions between parameters, providing more comprehensive analysis than traditional univariant methods .

For membrane proteins like lspA, additional considerations include the use of specific E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) and the potential addition of membrane-stabilizing agents during purification.

How can researchers optimize the purification of recombinant A. thermophilum lspA while maintaining its activity?

Purification of recombinant A. thermophilum lspA requires specialized approaches due to its nature as a membrane protein with multiple transmembrane domains. A methodological workflow includes:

  • Cell Lysis and Membrane Fraction Isolation:

    • Use gentle cell disruption methods (sonication or French press)

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization Strategy:

    • Select appropriate detergents (DDM, LDAO, or FC-12) at concentrations above critical micelle concentration

    • Include glycerol (10-20%) and salt (300-500 mM NaCl) in buffers to stabilize the protein

    • Maintain slightly alkaline pH (7.5-8.0) during solubilization

  • Chromatographic Purification:

    • Apply affinity chromatography using the protein's affinity tag

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography as a polishing step

  • Activity Preservation:

    • Maintain detergent concentration above CMC throughout purification

    • Store in buffer containing 50% glycerol at -20°C to -80°C

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

Activity assays should be performed at each purification step to monitor retention of enzymatic function, potentially using fluorescence resonance energy transfer (FRET)-based assays similar to those developed for other lspA proteins .

What methodologies are available for assessing the enzymatic activity of A. thermophilum lspA?

Several complementary approaches can be employed to assess A. thermophilum lspA activity:

  • FRET-Based High-Throughput Assays:

    • Develop fluorogenic peptide substrates containing the lipobox motif

    • Monitor cleavage through increase in fluorescence upon separation of quencher and fluorophore

    • This approach enables high-throughput screening for inhibitor discovery

  • Mass Spectrometry-Based Assays:

    • Analyze cleavage products using MALDI-TOF or LC-MS/MS

    • Quantify signal peptide removal from synthetic or natural substrates

    • Provides precise identification of cleavage sites

  • Inhibitor-Based Functional Assays:

    • Measure sensitivity to pepstatin (aspartic protease inhibitor)

    • Assess inhibition by globomycin, a known lspA inhibitor

    • Inhibitor profiling can confirm aspartyl peptidase classification

  • Mutagenesis Studies:

    • Generate site-directed mutants of conserved residues (particularly the catalytic aspartic acids)

    • Assess activity loss to confirm functional importance of specific residues

    • Compare with homologous enzymes to validate mechanistic conservation

When implementing these assays, researchers should consider the thermophilic nature of A. thermophilum and conduct activity measurements at elevated temperatures (50-70°C) to capture optimal enzymatic activity.

How does the structure and function of A. thermophilum lspA compare with homologs from other bacterial species?

Comparative analysis of lspA from various bacterial species reveals both conserved features and species-specific adaptations:

FeatureA. thermophilum lspAOther Bacterial lspASignificance
Transmembrane TopologyPredicted 4 TM domains4 TM domains confirmed in multiple speciesConserved structural organization
Catalytic ResiduesConserved aspartic acidsAsp-102 and Asp-129 (B. subtilis numbering) form catalytic dyadMechanistic conservation of aspartyl peptidase activity
Thermal StabilityAdapted for thermophilic conditionsMesophilic variants less thermostableReflects adaptation to ecological niche
Inhibitor SensitivityUnknownSensitive to globomycin and specific aspartyl protease inhibitorsPotential targeting strategies for antibiotics

The crystal structure of Pseudomonas aeruginosa lspA complexed with globomycin revealed that this inhibitor acts through molecular mimicry as a non-cleavable peptide that sterically blocks the active site . Comparative structural analysis would be valuable to determine if A. thermophilum lspA possesses unique features that might influence inhibitor binding or substrate specificity.

What is the potential of A. thermophilum lspA as a target for novel antibiotic development?

A. thermophilum lspA represents a promising target for antibiotic development based on several key attributes:

  • Essential Function: LspA is required for lipoprotein maturation, which is critical for bacterial viability across many species .

  • Prokaryotic Specificity: LspA is unique to prokaryotes, limiting potential off-target effects on host eukaryotic cells .

  • Druggability: The existence of natural inhibitors like globomycin demonstrates that the active site can be targeted by small molecules .

  • Broad Spectrum Potential: Conservation across bacterial species suggests inhibitors could have wide-spectrum antibacterial activity .

Several approaches for targeting lspA have been validated:

  • High-throughput screening has identified inhibitors with nanomolar IC50 values against lspA from certain bacteria

  • Structure-based drug design informed by crystal structures can lead to rational design of inhibitors

  • Combination therapy using lspA inhibitors with outer-membrane permeabilizers has shown efficacy against Gram-negative bacteria

For researchers pursuing A. thermophilum lspA as a drug target, the thermostability of this enzyme offers advantages for biochemical assays and structural studies. Additionally, insights from thermophilic enzymes often translate to mesophilic homologs, making discoveries with this enzyme potentially applicable to pathogenic bacterial targets.

How can researchers address the challenges in the heterologous expression of A. thermophilum lspA as a membrane protein?

Membrane proteins like A. thermophilum lspA present specific challenges in heterologous expression systems. Researchers can implement the following strategies to overcome these limitations:

  • Expression System Selection:

    • Evaluate multiple E. coli strains specifically designed for membrane protein expression

    • Consider cell-free expression systems that can directly incorporate detergents

    • Explore alternative hosts such as Lactococcus lactis or Pichia pastoris for difficult-to-express proteins

  • Fusion Protein Strategies:

    • N-terminal fusions with soluble partners (MBP, SUMO, or Trx)

    • C-terminal GFP fusion as a folding indicator and to monitor expression levels

    • Inclusion of purification tags positioned to avoid interference with membrane insertion

  • Codon Optimization and Expression Regulation:

    • Optimize codons for the expression host while preserving rare codons at critical folding junctures

    • Implement tight regulation of expression using tunable promoters

    • Apply statistical experimental design to systematically optimize expression parameters

  • Membrane Protein Solubilization and Stabilization:

    ApproachMethodologyAdvantage
    Detergent ScreeningSystematic testing of different detergent classesIdentifies optimal solubilization conditions
    Lipid SupplementationAddition of specific lipids during extractionEnhances stability of the solubilized protein
    Nanodiscs/AmphipolsAlternative membrane mimeticsMaintains native-like environment
    Thermostabilizing MutationsIntroduction of stabilizing mutationsImproves expression and handling properties

When implementing these strategies, researchers should monitor both protein quantity and quality. For A. thermophilum lspA, quality assessment should include verification of proper membrane insertion, oligomeric state analysis, and enzyme activity assays to confirm that the recombinant protein retains its native functionality.

What is the evolutionary significance of lspA in thermophilic bacteria like A. thermophilum?

The presence and conservation of lspA in thermophilic bacteria like A. thermophilum provide insights into the evolution of protein processing machinery under extreme conditions:

  • Thermoadaptation of Essential Processes:
    The retention of lspA in thermophiles indicates that lipoprotein processing is an essential function even at elevated temperatures. The enzyme likely underwent structural adaptations to maintain functionality under thermal stress while preserving its catalytic mechanism.

  • Conservation of Lipoprotein Pathways:
    The presence of the canonical lipoprotein processing pathway in thermophiles suggests this system evolved early in bacterial evolution and was maintained across diverse ecological niches, from mesophilic to thermophilic environments.

  • Specialization of Substrate Recognition:
    Thermophilic lspA enzymes may have evolved specialized mechanisms for substrate recognition that function optimally at high temperatures, potentially involving more hydrophobic interactions rather than hydrogen bonds.

  • Taxonomic Considerations:
    Recent reclassification of Anaerocellum thermophilum strain DSM 6725 within the Caldicellulosiruptor clade highlights the importance of considering evolutionary relationships when studying proteins from thermophilic organisms. This reclassification may affect interpretations of lspA evolution among thermophiles.

Comparative genomic analyses across diverse bacterial phyla suggest that lspA belongs to a core set of genes that were likely present in the last common ancestor of bacteria. Its preservation in thermophiles underscores the fundamental importance of lipoprotein processing for bacterial cell envelope structure and function across temperature extremes.

What strategies can researchers employ to improve the solubility of recombinant A. thermophilum lspA?

Improving solubility of membrane proteins like A. thermophilum lspA requires specialized approaches:

  • Expression Condition Optimization:

    • Lower induction temperature (25°C) reduces aggregation and promotes proper folding

    • Decreased IPTG concentration (0.1 mM) slows expression rate, allowing time for membrane insertion

    • Addition of membrane-stabilizing compounds (glycerol, specific ions) to culture media

    • Use of statistical experimental design to identify optimal combinations of variables

  • Genetic Engineering Approaches:

    • Truncation of non-essential domains while preserving membrane-spanning regions

    • Site-directed mutagenesis to replace aggregation-prone residues

    • Fusion to solubility-enhancing partners with cleavable linkers

    • Codon harmonization rather than simple codon optimization

  • Solubilization Strategy Development:

    • Systematic detergent screening (starting with mild detergents like DDM or LMNG)

    • Lipid supplementation during extraction (especially lipids from thermophilic organisms)

    • Use of specialized solubilization enhancers (arginine, proline, SDS at sub-micellar concentrations)

  • Storage Condition Optimization:

    • Inclusion of 50% glycerol for -20°C storage

    • Addition of specific lipids or detergents to stabilize the protein

    • Avoidance of repeated freeze-thaw cycles

    • Aliquoting into single-use volumes to maintain protein integrity

Researchers should monitor solubility not only through total protein yield but also through functional assays to ensure that soluble protein retains enzymatic activity. For A. thermophilum lspA, thermostability may actually be advantageous during purification as the protein might remain folded under conditions where mesophilic proteins would denature.

How can researchers develop effective high-throughput screening assays for A. thermophilum lspA inhibitors?

Developing effective high-throughput screening (HTS) assays for A. thermophilum lspA inhibitors requires careful assay design and validation:

  • FRET-Based Substrate Design:

    • Synthesize peptide substrates containing the lipobox motif from A. thermophilum lipoproteins

    • Incorporate fluorophore and quencher pairs flanking the cleavage site

    • Optimize peptide length for efficient cleavage and signal-to-noise ratio

    • Design controls to identify false positives from compound interference with fluorescence

  • Assay Optimization Parameters:

    ParameterConsiderationOptimization Approach
    TemperatureAccount for thermophilic natureTest range from 50-80°C for optimal activity
    pHDetermine pH optimumScreen pH range 5.0-9.0
    Buffer CompositionIdentify stabilizing conditionsTest various detergents and salt concentrations
    Enzyme ConcentrationDetermine optimal enzyme:substrate ratioTitrate enzyme to achieve linear reaction rate
    DMSO ToleranceAssess compatibility with compound librariesDetermine maximum DMSO percentage allowing activity
  • Validation and Quality Control:

    • Calculate Z' factor to ensure statistical robustness (aim for Z' > 0.7)

    • Include known inhibitors (globomycin, pepstatin) as positive controls

    • Implement counter-screens to exclude non-specific inhibitors

    • Incorporate orthogonal secondary assays (e.g., mass spectrometry) to confirm hits

  • Advanced Screening Strategies:

    • Implement thermal shift assays to identify compounds that bind and stabilize the enzyme

    • Consider fragment-based approaches using lower concentration compound libraries

    • Develop cellular assays using engineered bacteria with permeabilized outer membranes

The unique thermophilic properties of A. thermophilum lspA may actually provide advantages for HTS, as the enhanced stability could result in more robust assay performance and potentially reduce the false-positive rate encountered with less stable enzymes.

What are the potential causes and solutions for inconsistent activity of purified recombinant A. thermophilum lspA?

Inconsistent activity of purified recombinant A. thermophilum lspA may stem from several factors, each requiring specific troubleshooting approaches:

  • Protein Stability Issues:

    • Cause: Protein denaturation during purification or storage

    • Solution: Add 50% glycerol to storage buffer; store at -20°C or -80°C; avoid repeated freeze-thaw cycles; keep working aliquots at 4°C for up to one week

  • Incomplete Solubilization:

    • Cause: Insufficient or inappropriate detergent use

    • Solution: Screen multiple detergents; ensure detergent concentration remains above CMC throughout purification; consider addition of lipids from thermophilic organisms

  • Loss of Essential Cofactors:

    • Cause: Removal of metal ions or lipids during purification

    • Solution: Supplement purification buffers with divalent cations (Mg²⁺, Ca²⁺); add specific lipids that might be required for activity

  • Improper Assay Conditions:

    • Cause: Non-optimal temperature, pH, or buffer composition

    • Solution: Systematically optimize assay conditions considering the thermophilic nature (50-80°C); test different buffer systems and pH ranges

  • Aggregation During Storage:

    • Cause: Protein aggregation over time

    • Solution: Centrifuge protein before use (100,000 × g for 30 minutes); filter through 0.22 μm filter; add anti-aggregation agents (arginine, non-detergent sulfobetaines)

  • Oxidation of Critical Residues:

    • Cause: Oxidation of cysteine or methionine residues

    • Solution: Add reducing agents (DTT, TCEP) to buffers; prepare and store under nitrogen atmosphere

  • Proteolytic Degradation:

    • Cause: Contaminating proteases

    • Solution: Add protease inhibitors during purification; use highly purified detergents; perform additional purification steps

Systematic documentation of purification conditions, storage time, and activity measurements can help identify patterns of activity loss and develop effective preventative measures. For a thermophilic enzyme like A. thermophilum lspA, thermal stability testing at different temperatures can also help establish optimal handling conditions that preserve activity.

What novel applications might emerge from research on A. thermophilum lspA beyond antibiotic development?

Research on A. thermophilum lspA could lead to several innovative applications beyond antimicrobial development:

  • Biotechnological Applications:

    • Development of thermostable biocatalysts for industrial peptide modification

    • Creation of biosensors for detecting specific lipopeptides or signal sequences

    • Engineering modified lspA variants with altered substrate specificity for selective protein processing

  • Synthetic Biology Tools:

    • Incorporation into synthetic circuits for controlled protein processing in bacterial systems

    • Development of inducible protein secretion systems utilizing modified lspA recognition sequences

    • Creation of self-cleaving fusion tags for recombinant protein purification at elevated temperatures

  • Fundamental Research Applications:

    • Model system for studying protein evolution under extreme conditions

    • Investigation of membrane protein folding and stability in thermophiles

    • Exploration of protein-lipid interactions in thermophilic organisms

  • Commercial Enzyme Development:

    • Production of specialized peptidases for food processing applications requiring high-temperature stability

    • Development of detergent additives for high-temperature cleaning applications

    • Creation of research reagents for specialized proteomics applications

The thermostability of A. thermophilum lspA makes it particularly valuable for applications requiring operation at elevated temperatures or enhanced shelf stability, potentially opening avenues for use in conditions where mesophilic enzymes would rapidly denature.

How might structural biology approaches advance our understanding of A. thermophilum lspA?

Advanced structural biology techniques could significantly enhance our understanding of A. thermophilum lspA:

  • X-ray Crystallography/Cryo-EM Approaches:

    • Determination of high-resolution structure in different conformational states

    • Co-crystallization with substrates or inhibitors to elucidate binding mechanisms

    • Comparative analysis with mesophilic homologs to identify thermostabilizing features

    • Investigation of the structure in complex with globomycin to inform inhibitor design

  • Molecular Dynamics Simulations:

    • Exploration of protein dynamics at elevated temperatures

    • Investigation of water and ion movements within the transmembrane regions

    • Modeling of substrate binding and catalytic mechanism

    • Virtual screening of potential inhibitors against the binding pocket

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Probing protein dynamics and flexibility at different temperatures

    • Identifying regions with altered solvent accessibility upon substrate binding

    • Comparing conformational stability with mesophilic homologs

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Monitoring conformational changes during catalysis

    • Investigating the effects of temperature on protein dynamics

    • Examining protein-substrate interactions at the single-molecule level

The integration of these structural approaches could reveal the molecular basis for thermostability in A. thermophilum lspA and provide insights into substrate recognition and catalytic mechanism, potentially informing both fundamental understanding and applied research directions.

What genomic and proteomic approaches could expand our understanding of lspA function in A. thermophilum?

Comprehensive genomic and proteomic strategies can provide deeper insights into A. thermophilum lspA function:

  • Comparative Genomics:

    • Analysis of lspA conservation across Caldicellulosiruptor species

    • Identification of co-evolved genes suggesting functional interactions

    • Examination of genomic context for insights into regulation and functional associations

    • Investigation of horizontal gene transfer events involving lspA or associated genes

  • Transcriptomics Approaches:

    • RNA-seq analysis under various growth conditions to identify co-regulated genes

    • Determination of operon structure and transcriptional regulation

    • Investigation of sRNA regulation of lspA expression

    • Examination of transcriptional responses to environmental stresses

  • Proteomics Strategies:

    • Global identification of lipoproteins processed by lspA in A. thermophilum

    • Quantitative proteomics to measure effects of lspA inhibition or depletion

    • Analysis of membrane proteome alterations in response to lspA modulation

    • Interactome mapping to identify protein-protein interactions involving lspA

  • Functional Genomics:

    • CRISPR interference or antisense RNA approaches to modulate lspA expression

    • Construction of conditional mutants to study essentiality under different conditions

    • Site-directed mutagenesis of conserved residues to correlate sequence with function

    • Heterologous complementation studies with lspA from different bacterial species

These multi-omics approaches would provide a systems-level understanding of lspA function within the context of A. thermophilum biology, potentially revealing unexpected roles or regulatory mechanisms that could be exploited for biotechnological applications or antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.