Recombinant Anaerolinea thermophila Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
secF; ANT_16770; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)
Target Names
secF
Target Protein Sequence
MLNILGKRYLFFAISLAMIIPGLIVMAIFGLPLSIDFKGGSLLEVEFASKTLPAPAEVVA LYNDLGITDAQVTTTGNNTLLVRSSFIDDDVRAKVVQEMNSRFNDTVTVLRFDSVGPTIG KEVAGRATLAVSIAALAVIIYITWAFRGVHNAFRYGVCAIIAMIHDVLVVISLVSIGGVL FGWQVDALFLTALLSVIGFSVQDKVVVFDRIRENSQIYRKLDFEKLANHSIVQTLQRSIN TQLMTVEYMLLAIALFGGITLREFAIILLVGLFMGTYSSIFIAAPSLVIWESGEWRNWFK RGAKPASA
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Anaerolinea thermophila and why is its SecF protein significant?

Anaerolinea thermophila is a strictly anaerobic, filamentous bacterium belonging to the class Anaerolineae within the phylum Chloroflexi. It was the first cultivated strain in this class and was isolated from a thermophilic upflow anaerobic sludge blanket reactor processing fried soybean-curd manufacturing waste water . The SecF protein from A. thermophila is a subunit of the protein translocase system, which plays a critical role in protein secretion across the bacterial cell membrane. Studying SecF from thermophilic organisms like A. thermophila provides insights into how these essential cellular mechanisms function under extreme temperature conditions. The genome of A. thermophila UNI-1 consists of a single circular chromosome (3,532,378 bp) with a G+C content of 53.8%, containing 3,179 predicted protein-coding genes .

What is the function of the SecF protein in bacterial systems?

The SecF protein functions as an essential component of the bacterial Sec translocase system, which is responsible for the transport of proteins across the cytoplasmic membrane. In bacterial systems, SecF typically forms a complex with SecD and SecY components to facilitate protein translocation. The SecDF complex utilizes the proton motive force to drive protein export and assists in the later stages of protein translocation by preventing backward movements of partially translocated proteins. In thermophilic organisms like A. thermophila, the SecF protein likely has evolved specific structural adaptations that allow it to function efficiently at elevated temperatures, potentially contributing to the thermal stability of the entire secretion system.

What are the optimal storage and handling conditions for recombinant A. thermophila SecF protein?

For optimal storage and handling of recombinant A. thermophila SecF protein:

  • Storage buffer: The protein is typically supplied in a Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • Storage temperature: Store the protein at -20°C for regular use, or at -80°C for extended storage periods .

  • Working aliquots: When conducting experiments, prepare working aliquots and store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

These conditions help maintain the structural integrity and functional activity of the protein for experimental applications.

What expression systems are most effective for producing recombinant A. thermophila SecF?

While specific expression systems for A. thermophila SecF are not detailed in the search results, based on general principles for expressing membrane proteins from thermophilic organisms, the following approaches are typically effective:

  • E. coli-based expression systems:

    • BL21(DE3) strains with tunable promoters like T7-lac

    • C41(DE3) and C43(DE3) strains engineered for membrane protein expression

    • Fusion with solubility tags (MBP, SUMO, or TrxA) to improve expression and folding

  • Thermophilic expression hosts:

    • Thermus thermophilus expression systems for proteins requiring thermophilic cellular machinery

    • Geobacillus species as alternative expression hosts

  • Expression conditions:

    • Lower induction temperatures (16-25°C) despite the thermophilic origin

    • Extended expression times (16-24 hours)

    • IPTG concentrations between 0.1-0.5 mM for induction

The choice of expression system should be experimentally determined based on protein yield, solubility, and functional activity.

What purification strategies are most successful for isolating functional SecF protein?

Effective purification strategies for membrane proteins like SecF typically include:

  • Membrane preparation:

    • Cell disruption via sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

  • Solubilization:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM), LDAO, or digitonin

    • Solubilization buffer containing stabilizing agents (glycerol, specific lipids)

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography to remove aggregates and achieve high purity

    • Ion exchange chromatography as a polishing step

  • Stabilization during purification:

    • Inclusion of lipids or lipid-like molecules during purification

    • Maintaining temperature slightly above room temperature (25-30°C)

    • Buffer optimization with stabilizing agents

The specific tag used for the recombinant protein would typically be determined during the production process and should be taken into account when designing the purification strategy .

How does the structure of SecF from A. thermophila compare with homologs from mesophilic bacteria?

While specific structural comparison data between A. thermophila SecF and mesophilic homologs is not provided in the search results, general principles of thermophilic protein adaptation can be applied:

  • Thermostability features likely present in A. thermophila SecF:

    • Increased number of ionic interactions and salt bridges

    • Higher proportion of charged amino acids on the protein surface

    • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

    • Compacted hydrophobic core with enhanced packing

    • Shorter surface loops and reduced cavity volumes

  • Comparative analysis with mesophilic SecF proteins:

    • Based on evolutionary trends in the Anaerolineaceae family, thermophilic members tend to have specific adaptations for heat stress, including specialized heat shock proteins and other thermostability-conferring features

    • The genomic analysis of Anaerolineaceae suggests that thermophilic members retain specific proteins absent in mesophilic counterparts

The thermophilic nature of A. thermophila would likely be reflected in SecF structural adaptations that enhance stability at elevated temperatures while maintaining the flexibility needed for function.

What role does SecF play in the thermal adaptation of protein secretion in A. thermophila?

The SecF protein likely plays a critical role in the thermal adaptation of protein secretion in A. thermophila through several mechanisms:

  • Maintenance of membrane integrity:

    • As a membrane protein, SecF would need specific adaptations to function in the more fluid membranes characteristic of thermophilic organisms

    • The transmembrane domains of thermophilic SecF likely have increased hydrophobicity and length to accommodate thermally-induced membrane changes

  • Energy coupling efficiency:

    • The SecDF complex utilizes the proton motive force to drive protein translocation

    • In thermophilic organisms, this energy coupling must remain efficient at elevated temperatures

    • Structural adaptations in SecF would contribute to maintaining this efficiency

  • Protein translocation mechanics:

    • The SecF protein assists in preventing backward sliding of translocating proteins

    • In thermophilic environments, both the translocating proteins and the translocase machinery must maintain their functional interactions at high temperatures

    • The SecF component likely contains adaptations that preserve these critical interactions

  • Integration with thermophilic stress responses:

    • Studies of thermophilic Anaerolineaceae have identified specific proteins involved in heat stress adaptation

    • The protein secretion system, including SecF, would need to coordinate with these stress response systems

These adaptations collectively ensure that protein secretion remains functional under the thermophilic growth conditions of A. thermophila.

What is known about the interaction of SecF with other components of the Sec translocase system in A. thermophila?

While specific interaction data for A. thermophila SecF is not provided in the search results, general principles of Sec translocase organization allow us to infer likely interactions:

  • Core interactions:

    • SecF typically forms a complex with SecD and interacts functionally with the SecYEG channel

    • These interactions are likely conserved in A. thermophila based on the fundamental conservation of the Sec pathway

  • Species-specific adaptations:

    • The thermophilic nature of A. thermophila suggests potential adaptations in interaction interfaces

    • Enhanced ionic interactions may stabilize protein-protein contacts at elevated temperatures

  • Functional coupling:

    • The SecDF complex couples protein translocation to the proton motive force

    • In thermophiles, these energy-coupling mechanisms may have unique features to maintain efficiency at high temperatures

  • Membrane environment considerations:

    • The lipid composition of thermophilic membranes differs from mesophilic organisms

    • These differences likely influence how SecF interacts with other membrane proteins and the lipid bilayer itself

Further structural and biochemical studies specifically focused on the A. thermophila Sec system would be necessary to fully characterize these interactions.

How has the SecF protein evolved within the Chloroflexi phylum?

The evolutionary context of SecF within the Chloroflexi phylum can be understood in terms of the broader evolutionary patterns observed in this group:

  • Phylogenetic context:

    • Anaerolinea thermophila belongs to the class Anaerolineae within the Chloroflexi phylum

    • This class contains diverse environmental sequences but relatively few cultivated strains

    • A. thermophila was the first cultivated strain in this class

  • Evolutionary adaptations:

    • The Anaerolineaceae family shows evolutionary trends related to thermal adaptation

    • In thermophilic members, specific proteins related to heat stress response have been identified

    • Essential systems like protein secretion would be subject to selective pressure to maintain function under thermophilic conditions

  • Comparative genomics:

    • Genomic analysis of thermophilic Anaerolineaceae members has revealed specific orthologous proteins exclusive to thermophiles, absent in mesophiles

    • These include heat shock proteins, chaperones, and stress response proteins

    • The SecF protein, as part of an essential cellular system, likely shows conservation of core functional domains while displaying thermophilic adaptations

  • Evolutionary trends in the family:

    • Analysis suggests that mesophilic Anaerolineaceae may have evolved from thermophilic ancestors

    • This evolutionary trajectory may be reflected in the structure and function of essential proteins like SecF

Further phylogenetic analysis specifically focused on SecF sequences across the Chloroflexi phylum would provide more detailed insights into its evolutionary history.

What methodological approaches can be used to study the functional dynamics of SecF in thermophilic conditions?

Several methodological approaches are particularly suitable for studying the functional dynamics of SecF in thermophilic conditions:

  • Biophysical techniques for thermal stability analysis:

    • Differential scanning calorimetry (DSC) to determine thermal transition points

    • Circular dichroism (CD) spectroscopy at varying temperatures to monitor secondary structure changes

    • Thermal shift assays to identify stabilizing buffer conditions

  • Structural approaches:

    • X-ray crystallography of the thermophilic SecF protein, potentially in complex with other Sec components

    • Cryo-electron microscopy to visualize the SecF in its native membrane environment

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics at different temperatures

  • Functional assays:

    • Reconstitution of the Sec system in proteoliposomes with temperature-dependent translocation assays

    • Proton transport measurements to assess energy coupling at elevated temperatures

    • In vitro protein translocation assays with purified components at varying temperatures

  • Computational methods:

    • Molecular dynamics simulations at elevated temperatures to model conformational behavior

    • Comparative sequence analysis across thermophilic and mesophilic SecF homologs

    • Energy landscape calculations to identify thermostabilizing interactions

These approaches would provide complementary insights into how the SecF protein functions under the thermophilic conditions native to A. thermophila.

What are the current challenges in expressing and purifying functional SecF for structural studies?

Researchers face several challenges when working with SecF for structural studies:

  • Expression challenges:

    • As a membrane protein, SecF is inherently difficult to express in heterologous systems

    • The thermophilic origin adds complexity, as expression hosts may not provide the appropriate folding environment

    • Toxicity issues may arise when overexpressing membrane proteins involved in secretion

  • Purification obstacles:

    • Maintaining the native conformation during extraction from membranes

    • Finding detergents that effectively solubilize without destabilizing the protein

    • Preventing aggregation during concentration steps

    • Removing lipids while maintaining structural integrity

  • Stability considerations:

    • Balancing thermostability with conformational flexibility needed for function

    • Identifying conditions that mimic the native thermophilic environment

    • Preventing degradation during purification and crystallization attempts

  • Structural analysis limitations:

    • Obtaining crystals suitable for X-ray diffraction

    • Achieving sufficient resolution in cryo-EM studies

    • Capturing functionally relevant conformational states

These challenges require innovative approaches combining detergent screening, protein engineering, and advanced structural biology techniques.

How might understanding A. thermophila SecF contribute to biotechnological applications?

Insights from A. thermophila SecF could contribute to several biotechnological applications:

  • Engineering thermostable protein secretion systems:

    • Identification of thermostabilizing features in SecF could inform engineering of secretion systems for industrial enzymes

    • Enhanced secretion efficiency at elevated temperatures could improve bioproduction processes

  • Membrane protein expression technologies:

    • Principles learned from thermophilic SecF could improve expression systems for difficult membrane proteins

    • Novel solubilization and stabilization strategies might emerge from studying thermophilic membrane proteins

  • Bioremediation applications:

    • A. thermophila was isolated from waste water treatment systems

    • Understanding its protein secretion machinery could inform engineering of strains for enhanced bioremediation at elevated temperatures

  • Structural biology advancements:

    • Thermophilic proteins often provide advantages for structural studies due to their inherent stability

    • Methodological advances in studying SecF could be applied to other challenging membrane proteins

  • Protein translocation biotechnology:

    • Insights into thermostable translocation machinery could inform development of novel protein production platforms

    • Engineering protein secretion for harsh industrial conditions

These applications highlight the translational potential of basic research on A. thermophila SecF.

What computational approaches can predict functional motifs in SecF that contribute to thermostability?

Several computational approaches can be employed to predict thermostability-contributing motifs in SecF:

  • Comparative sequence analysis:

    • Multiple sequence alignment of SecF homologs from organisms with varying optimal growth temperatures

    • Identification of thermophile-specific sequence motifs or amino acid composition biases

    • Analysis of coevolutionary patterns between residues

  • Structural bioinformatics:

    • Homology modeling based on existing SecF structures from other organisms

    • Calculation of electrostatic interaction networks and comparison with mesophilic homologs

    • Identification of regions with altered flexibility profiles

  • Molecular dynamics simulations:

    • Simulations at elevated temperatures to identify stabilizing interactions

    • Comparison of unfolding pathways between thermophilic and mesophilic homologs

    • Free energy calculations to quantify the contribution of specific interactions

  • Machine learning approaches:

    • Training models on datasets of thermophilic and mesophilic proteins to predict thermostabilizing features

    • Feature extraction from sequence and predicted structural properties

    • Neural network-based prediction of thermal stability from primary sequence

  • Energy landscape analysis:

    • Calculation of folding energy landscapes at different temperatures

    • Identification of energy barriers and kinetic traps

    • Prediction of conformational changes relevant to function

These computational approaches provide testable hypotheses that can guide experimental design for understanding the thermostability determinants in A. thermophila SecF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.