Recombinant Anaeromyxobacter dehalogenans ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ftsH; A2cp1_2158; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Target Names
ftsH
Target Protein Sequence
MSADEKKGHGQRSERGRGPGGPGTQPRIPLASPAAWLVLIALAIFLFRAFQDVGVRRIPY SQFKEMVRQSAFERVVIGPDWVRGVPKPVEAGAAQGGGAQPQQQAQGEGERNGQALPYVA TRIPGGGDDLVQAVEKAGVPYDAVAGGGMGDLFWVWIAPIAIGLLFWAWVMRRMSGQLGQ GPPGVMAFGKSRARIHMEPDTGVTFQDAAGIDEAVEELQEIVEFLKTPEKYRRLGGRIPK GVLLVGPPGTGKTLLARATAGEAGVPFFSLSGSEFVEMFVGVGAARVRDLFAQATQKAPC IVFIDELDALGKSRNAGIMGGHDEREQTLNQLLAEMDGFDARAGLIIMGATNRPEILDPA LLRPGRFDRQVLVDRPDKRGREQILRIHARNVKLGPDVDLRSVAARTPGFAGADLANVVN EAALLAARRNKNHVTRAEFEEAIERVVAGLEKKSRRINEREKEIVAFHEAGHALVSWMLP FADRVSKVSIIPRGLGALGYTLQLPLEDRYLLTRSELRDRMAGLMGGRVAEEEVFGEPST GASNDLQHATAVARMMVRDYGMSPALGPVSLGDQNGPSFLGVKGFETRSYSDHTALAVDR EVQALVEEAQDRARTVVREHRERLEALAARLLTIEVVEEDEITRLWGPKVVRPGTIEGRG HEESPPETPNRPVAASADASAGFGRSGPQPPQALARHAGGDPDPES
Uniprot No.

Target Background

Function

This recombinant Anaeromyxobacter dehalogenans ATP-dependent zinc metalloprotease FtsH functions as a processive, ATP-dependent enzyme, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Anaeromyxobacter dehalogenans and why is its FtsH protein significant?

Anaeromyxobacter dehalogenans is a versatile soil bacterium that belongs to the family Myxococcaceae within the class Myxobacteria. It represents the first taxon in the Myxococcaceae capable of anaerobic growth and has unique metabolic capabilities including chlororespiration, nitrate reduction, and iron reduction . The organism forms a physiologically and phylogenetically coherent group that branches deeply within the Myxococcaceae family, sharing some characteristics with previously characterized myxobacteria but lacking the characteristic fruiting body formation . A. dehalogenans ATP-dependent zinc metalloprotease FtsH is a 706-amino acid protein that plays critical roles in protein quality control and cellular homeostasis mechanisms . This metalloprotease is particularly significant because it represents an important component of the organism's stress response system and may contribute to the remarkable metabolic versatility of A. dehalogenans, including its ability to thrive in diverse environmental conditions and utilize various electron donors and acceptors .

How is recombinant A. dehalogenans FtsH protein typically expressed and purified?

Recombinant A. dehalogenans FtsH protein is commonly expressed in E. coli expression systems using a His-tag fusion strategy for simplified purification . The full-length protein (amino acids 1-706) is cloned into an appropriate expression vector with an N-terminal His-tag sequence that facilitates subsequent affinity chromatography purification . After induction and expression, cells are typically lysed, and the recombinant protein is isolated using nickel or cobalt affinity chromatography, where the His-tagged protein binds to the metal-charged resin while contaminating proteins are washed away. Elution is generally performed with an imidazole gradient, followed by additional purification steps such as ion exchange or size exclusion chromatography to achieve high purity (>90% as determined by SDS-PAGE) . The purified protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, with recommended storage at -20°C/-80°C and the addition of 5-50% glycerol for long-term stability .

What are the optimal storage conditions for recombinant A. dehalogenans FtsH to maintain its activity?

For optimal preservation of recombinant A. dehalogenans FtsH activity, the protein should be stored as a lyophilized powder at -20°C/-80°C until ready for use . When reconstituting the protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol to a final concentration of 5-50% (with 50% being the default recommendation) . This glycerol addition is crucial for preventing protein denaturation during freeze-thaw cycles. For working aliquots, storage at 4°C is suitable for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity and enzymatic activity . Before opening any stored vial, it should be briefly centrifuged to bring the contents to the bottom, particularly important for lyophilized preparations . For experiments requiring extended storage of ready-to-use protein, creating multiple small-volume aliquots is strongly recommended to minimize the need for repeated thawing of the entire preparation.

What electron donors and acceptors are utilized by A. dehalogenans in its natural metabolism?

A. dehalogenans demonstrates remarkable metabolic versatility through its ability to utilize various electron donors and acceptors. The bacterium can employ acetate, H₂, succinate, pyruvate, formate, and lactate as electron donors in its respiratory processes . Research has confirmed these electron donors' utilization through experimental verification, where the consumption of these compounds was monitored alongside reductive dechlorination activity . For electron acceptors, A. dehalogenans can use 2-chlorophenol (2-CPh), which is reduced to phenol, with this dechlorination process being preferred over nitrate reduction when both are available . The organism can reduce nitrate to ammonium through a respiratory ammonification pathway . Additionally, A. dehalogenans can couple growth to N₂O reduction to N₂ and can reduce Fe(III) to Fe(II) . Notably, the bacterium cannot grow by fermentation, highlighting its strict dependence on respiratory metabolism utilizing these electron donors and acceptors .

How does the unique metabolic versatility of A. dehalogenans influence the function and expression of its FtsH protease?

The exceptional metabolic capabilities of A. dehalogenans, including its ability to perform reductive dechlorination, nitrate reduction to ammonium, N₂O reduction to N₂, and Fe(III) reduction to Fe(II), likely place distinctive regulatory demands on its FtsH protease system . The FtsH metalloprotease in A. dehalogenans potentially plays a crucial role in adapting the proteome to changing redox conditions and electron acceptor availability. When the organism shifts between different respiratory pathways—for example, from chlororespiration to nitrate reduction—substantial changes in membrane protein composition are required, which would necessitate precise proteolytic regulation by FtsH . The protease likely contributes to the removal of damaged or unnecessary proteins during these metabolic shifts, particularly under stressful environmental conditions like redox fluctuations or nutrient limitations. Research investigating FtsH expression profiles under various electron acceptor conditions (2-CPh, nitrate, Fe(III), or N₂O) could reveal important regulatory mechanisms by which this protease facilitates A. dehalogenans' remarkable respiratory flexibility and environmental adaptability.

What is the significance of the biotic-abiotic linked reactions in A. dehalogenans denitrification process, and how might this impact experimental design when studying its FtsH function?

A. dehalogenans exhibits a unique denitrification mechanism involving linked biotic-abiotic reactions despite lacking the hallmark denitrification genes nirS and nirK (which encode NO₂⁻→NO reductases) . This microorganism can reduce Fe(III) to Fe(II), which subsequently reacts chemically with NO₂⁻ to form N₂O (chemodenitrification) . Experimental evidence shows that following the addition of 100 μmol of NO₃⁻ or NO₂⁻ to Fe(III)-grown axenic cultures of A. dehalogenans, substantial amounts of N₂O-N (54±7 μmol and 113±2 μmol, respectively) were produced and then consumed . When studying FtsH function in A. dehalogenans, researchers must account for these complex linked reactions, as they represent an unrecognized ecophysiology that traditional genomic analysis would miss . Experimental designs studying FtsH regulation or activity should carefully control redox conditions and consider measuring Fe(II) production, NO₃⁻/NO₂⁻ consumption, and N₂O production/consumption simultaneously. These linked reactions highlight that protein function in A. dehalogenans may be influenced by chemical reactions occurring outside the cell, adding a layer of complexity to interpreting proteolytic regulation data.

What role might FtsH play in A. dehalogenans' tolerance to environmental contaminants and its reductive dechlorination capabilities?

A. dehalogenans FtsH likely plays a crucial role in the organism's remarkable ability to tolerate and metabolize environmental contaminants, particularly chlorinated compounds like 2-chlorophenol (2-CPh) . As an ATP-dependent metalloprotease, FtsH would be instrumental in removing damaged membrane proteins resulting from exposure to toxic chlorinated compounds, thereby maintaining membrane integrity during reductive dechlorination processes . The protein quality control function of FtsH may be particularly important during dechlorination, as this metabolic process generates reactive intermediates that could damage cellular proteins. Experimental evidence shows that A. dehalogenans utilizes acetate, H₂, succinate, pyruvate, formate, and lactate as electron donors for reductive dechlorination, suggesting that FtsH might be differentially regulated depending on the available carbon source to optimize the cellular proteome for specific metabolic pathways . Future research could explore whether FtsH knockout or down-regulation affects A. dehalogenans' chlororespiration efficiency, potentially revealing new connections between protein quality control and xenobiotic metabolism in this environmentally significant bacterium.

What assays are most suitable for measuring the proteolytic activity of recombinant A. dehalogenans FtsH protein?

For assessing the proteolytic activity of recombinant A. dehalogenans FtsH protein, several complementary approaches can be implemented. Fluorescence-based assays using fluorogenic peptide substrates provide a sensitive and quantitative method for measuring FtsH activity, where the release of fluorescent groups upon proteolytic cleavage can be monitored in real-time using a spectrofluorometer. Alternatively, researchers can employ SDS-PAGE-based degradation assays using known FtsH substrates (such as σ32, λ cI, or YccA from E. coli), where the disappearance of substrate bands over time indicates proteolytic activity. Given that FtsH is an ATP-dependent protease, activity assays should include conditions both with and without ATP to confirm ATP dependence, and zinc chelators such as EDTA can be used as controls to verify the metalloprotease mechanism . Temperature and pH optimization experiments are crucial, as A. dehalogenans' unusual physiology might result in FtsH activity parameters that differ from model organisms. For more detailed mechanistic studies, researchers might consider developing a continuous coupled-enzyme assay that measures ATP hydrolysis during proteolysis, providing insights into the energetic coupling between ATP hydrolysis and protein degradation by the recombinant FtsH.

How can researchers effectively analyze the interaction between FtsH and the denitrification machinery in A. dehalogenans?

To investigate the potential interactions between FtsH and the denitrification machinery in A. dehalogenans, researchers should implement a multi-faceted approach combining physiological, biochemical, and molecular techniques. Co-immunoprecipitation experiments using antibodies against FtsH can identify potential protein interaction partners within the denitrification pathway, while bacterial two-hybrid or split-ubiquitin assays could verify specific protein-protein interactions. Given A. dehalogenans' unusual denitrification pathway involving linked biotic-abiotic reactions in the absence of nirS and nirK genes, quantitative proteomic analysis comparing wild-type and FtsH-depleted strains under various nitrate-reducing conditions would be particularly informative . Measurements of Fe(III) reduction, NO₃⁻ consumption, and N₂O production/consumption in these strains could reveal whether FtsH influences these processes . Additionally, researchers could construct an FtsH variant with a protease-inactive mutation to differentiate between the structural and enzymatic roles of FtsH in denitrification. Membrane fractionation studies might also be valuable, as both FtsH and many denitrification enzymes are membrane-associated, making the membrane interface a likely location for functional interactions.

What experimental setup would best capture the impact of FtsH on A. dehalogenans' distinctive iron reduction capabilities?

To effectively study the relationship between FtsH and iron reduction in A. dehalogenans, a comprehensive experimental setup should include comparative growth assays with wild-type and FtsH-depleted strains on various Fe(III) sources (such as ferric citrate, ferrihydrite, or Fe(III)-NTA). Monitoring both growth rates and Fe(II) production using the ferrozine assay would provide quantitative data on the impact of FtsH on iron reduction efficiency . Since A. dehalogenans can couple Fe(III) reduction with linked denitrification processes, experiments should also measure nitrogen compounds (NO₃⁻, NO₂⁻, N₂O, NH₄⁺) alongside Fe(II) production . RNA-Seq or quantitative RT-PCR analysis comparing gene expression patterns between wild-type and FtsH-mutant strains during Fe(III) reduction could identify regulatory connections between FtsH and iron-reducing pathways. Biochemical fractionation followed by activity assays and proteomic analysis would help determine whether FtsH directly processes components of the iron-reducing machinery. Additionally, researchers should consider the kinetics of adaptation when shifting A. dehalogenans from other electron acceptors to Fe(III), as this transition period might represent a critical time when FtsH-mediated protein quality control significantly influences the remodeling of the respiratory apparatus.

How should researchers interpret contradictory results when studying FtsH function across different growth conditions in A. dehalogenans?

When confronting contradictory results regarding FtsH function across varying growth conditions in A. dehalogenans, researchers should systematically consider several factors specific to this versatile bacterium. First, the organism's remarkable metabolic flexibility—spanning reductive dechlorination, respiratory ammonification, and Fe(III) reduction—suggests that FtsH may play condition-specific roles with potentially opposing effects depending on the electron acceptor present . Researchers should examine whether contradictory findings correlate with specific electron donors (acetate, H₂, succinate, pyruvate, formate, or lactate) or acceptors (2-CPh, nitrate, Fe(III), or N₂O), as each combination may trigger different proteolytic requirements . Given A. dehalogenans' involvement in linked biotic-abiotic reactions, apparent contradictions might actually reflect the interference of extracellular chemical processes rather than direct FtsH effects . Temporal considerations are also crucial, as FtsH might exert different effects during adaptation phases versus steady-state growth. Statistical analysis should incorporate biological replicates from independent cultures rather than technical replicates alone, and researchers should report growth phase, cell density, and detailed medium composition to enable proper interpretation. Finally, considering that FtsH functions within a broader protein quality control network, contradictory results might reflect compensatory changes in other proteases or chaperones that vary across growth conditions.

What computational approaches are most effective for analyzing the substrate specificity of A. dehalogenans FtsH?

For computational analysis of A. dehalogenans FtsH substrate specificity, researchers should employ a multi-tiered bioinformatic approach beginning with sequence-based prediction tools. Using the full 706-amino acid sequence of the protein, comparative analysis with well-characterized FtsH proteins can identify conserved substrate-binding motifs and catalytic sites . Homology modeling based on crystal structures of FtsH proteins from other species can provide insights into the three-dimensional arrangement of the substrate-binding pocket, which can then be validated through molecular dynamics simulations to assess stability and substrate interaction potential. Machine learning algorithms trained on known protease-substrate pairs can be applied to predict potential A. dehalogenans FtsH substrates within its proteome, particularly focusing on membrane proteins involved in respiratory pathways relevant to its unique metabolism . These predictions should be filtered using subcellular localization information, as FtsH typically degrades membrane-associated proteins. Network analysis incorporating transcriptomic and proteomic data can identify proteins whose abundance inversely correlates with FtsH expression, suggesting possible degradation targets. For advanced analysis, computational docking studies between the modeled FtsH structure and predicted substrate proteins can reveal binding energies and interaction details, prioritizing candidates for experimental validation.

How can researchers differentiate between direct and indirect effects of FtsH on A. dehalogenans' nitrogen metabolism?

To distinguish between direct and indirect effects of FtsH on A. dehalogenans' nitrogen metabolism, researchers must implement a strategic experimental framework with appropriate controls and mechanistic investigations. Direct FtsH effects would involve proteolytic processing of nitrogen metabolism components, which can be detected through targeted proteomics comparing the abundance and processing patterns of these proteins in wild-type versus FtsH-depleted strains . In vitro degradation assays using purified recombinant FtsH and candidate substrate proteins from nitrogen metabolism pathways would provide definitive evidence of direct proteolytic relationships. To identify indirect effects, researchers should conduct time-course transcriptomic and proteomic analyses following FtsH depletion, looking for cascading changes that indicate regulatory rather than direct proteolytic consequences. Metabolic flux analysis comparing nitrogen compound transformations (particularly focusing on the conversion of NO₃⁻ to NH₄⁺ or N₂) between wild-type and FtsH-mutant strains would reveal functional metabolic consequences . Given A. dehalogenans' unusual denitrification through linked biotic-abiotic reactions, researchers should also measure Fe(II) production alongside nitrogen compound transformations to assess whether FtsH indirectly affects denitrification by altering iron reduction capacity . Complementation experiments introducing either wild-type FtsH or catalytically inactive variants can further differentiate between structural and enzymatic roles of the protease in nitrogen metabolism.

What emerging technologies could advance our understanding of A. dehalogenans FtsH in environmental remediation applications?

Emerging technologies that could substantially advance our understanding of A. dehalogenans FtsH in environmental remediation include advanced in situ protein tracking methods such as split fluorescent protein systems or proximity labeling techniques (BioID, APEX) that could monitor FtsH interactions during active bioremediation processes . CRISPR-Cas9 genome editing, optimized for A. dehalogenans, would enable precise modification of FtsH and associated proteins to determine their specific contributions to chlororespiration and other remediation-relevant metabolic pathways . Microfluidic devices coupled with real-time imaging could allow researchers to observe single-cell protein dynamics during exposure to environmental contaminants, potentially revealing heterogeneity in FtsH activity within microbial populations during remediation. Environmental metabolomics and metaproteomics would help connect laboratory findings to field conditions by identifying metabolites and proteins associated with FtsH activity in complex environmental samples. Synthetic biology approaches could engineer optimized versions of FtsH or create synthetic consortia where modified A. dehalogenans strains with enhanced FtsH function work synergistically with other microorganisms to improve bioremediation efficiency. Additionally, biomimetic systems incorporating purified A. dehalogenans FtsH into artificial membrane structures could potentially catalyze specific degradation reactions of environmental interest, expanding the application potential beyond living cells.

How might the study of A. dehalogenans FtsH inform our understanding of protease function in microorganisms with complex respiratory versatility?

Research on A. dehalogenans FtsH provides a unique opportunity to understand protease function in metabolically versatile bacteria that employ multiple respiratory pathways. This organism's ability to switch between reductive dechlorination, nitrate reduction, N₂O reduction, and Fe(III) reduction represents an ideal model system for studying how proteases regulate respiratory flexibility . By investigating how FtsH expression and substrate specificity change during transitions between different electron acceptors, researchers can develop broader principles regarding proteolytic control of respiratory remodeling. Comparative analysis of FtsH function in A. dehalogenans versus microorganisms with less respiratory versatility could reveal specialized adaptations in protease regulation that enable metabolic flexibility. The organism's unusual denitrification pathway involving linked biotic-abiotic reactions without nirS/nirK genes highlights the importance of looking beyond genomic predictions to understand protease contributions to emergent metabolic capabilities . This research direction could establish a framework for predicting how proteolytic systems in other bacteria might respond to changing redox conditions in complex environments. Additionally, findings from A. dehalogenans FtsH studies may inform synthetic biology efforts to engineer microorganisms with enhanced respiratory capabilities for bioremediation, bioenergy production, or biochemical synthesis by identifying key proteolytic control points that enable successful pathway switching.

What potential biotechnological applications might emerge from detailed characterization of recombinant A. dehalogenans FtsH protein?

Detailed characterization of recombinant A. dehalogenans FtsH protein could enable multiple biotechnological applications leveraging its ATP-dependent proteolytic capabilities and unique substrate specificity. Given A. dehalogenans' remarkable ability to degrade chlorinated compounds, its FtsH may have evolved specificity for processing proteins damaged by these environmental contaminants, potentially leading to novel bioremediation technologies where the purified enzyme or engineered variants could be deployed in contaminated sites to enhance degradation efficiency . The protein's natural function in a bacterium capable of linking Fe(III) reduction with denitrification suggests potential applications in wastewater treatment systems targeting simultaneous removal of nitrates and metal contaminants . Structure-function studies of the recombinant protein (706 amino acids) could inform the design of synthetic proteases with customized degradation specificity for biotechnological applications such as controlled protein turnover in industrial enzyme processes or targeted degradation of problematic proteins in medical applications . Additionally, understanding the molecular mechanisms by which FtsH enables A. dehalogenans to thrive in contaminated environments could lead to the development of robust protein production systems capable of functioning in harsh industrial conditions. Engineered A. dehalogenans FtsH variants could also potentially serve as molecular tools for studying membrane protein topology and quality control in diverse experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.