Recombinant Anaeromyxobacter dehalogenans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Gene NameatpB (Adeh_4340 in strain 2CP-C)
Protein Length381–384 amino acids (species-dependent)
Molecular FunctionProton translocation, ATP synthesis regulation
Host SystemsE. coli, Yeast, Baculovirus, Mammalian cells
Purity≥85% (SDS-PAGE)

Production and Purification

Recombinant atpB is produced via heterologous expression systems, often fused with affinity tags (e.g., His-tag) for purification .

Expression and Purification Workflow:

  1. Cloning: The atpB gene (e.g., UniProt ID Q2IHP4 or B4UJU7) is inserted into expression vectors .

  2. Host Cultivation: Expressed in E. coli or other hosts under optimized conditions .

  3. Purification: Affinity chromatography followed by buffer exchange into Tris/PBS-based storage buffers .

  4. Quality Control: Validated via SDS-PAGE and mass spectrometry .

Amino Acid Sequence Analysis

The full-length sequence of recombinant atpB includes conserved transmembrane domains critical for proton channel activity.

Partial Sequence (Strain 2CP-C) :

SegmentSequence
N-TermMTAATLVTLALSLSLAQHDAAPAPAPAAVEQHGAAPEAAASADPHAAPAGEHGAAVEAHAAA...
Mid...GYVIEHPGFCNGAFAWNCEWDLRATFGDALKFGKLDLTPTKHVIMMWLASALLLVVVL...
C-Term...FIGAGLVHHGDDHGHAEEHGHAGPGMGSEHGSHVAGASPGHG

Functional Role in ATP Synthase Complex

ATP synthase in A. dehalogenans comprises multiple subunits (atpA–atpH), with atpB forming the proton-conducting channel . Key interactions include:

  • atpF (subunit B): Stabilizes the F0 sector .

  • atpD (subunit β): Catalyzes ATP formation in the F1 sector .

  • atpE (subunit C): Facilitates proton movement .

Predicted Functional Partners :

SubunitFunctionInteraction Score
atpFF0 sector stabilization0.999
atpD-2Catalytic ATP synthesis0.999
atpEProton channel activity0.998

Genomic and Evolutionary Significance

The atpB gene in A. dehalogenans reflects the organism’s mosaic genome, which includes horizontally acquired genes from anaerobic green sulfur bacteria . This adaptability underscores its role in diverse respiratory pathways, bridging aerobic and anaerobic metabolism .

Research Applications

  • Enzymatic Studies: Investigating proton-driven ATP synthesis mechanisms .

  • Structural Biology: Cryo-EM studies of ATP synthase architecture .

  • Antigen Development: Potential use in antibody production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
atpB; Adeh_4340; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Anaeromyxobacter dehalogenans (strain 2CP-C)
Target Names
atpB
Target Protein Sequence
MTAATLVTLALSLSLAQHDAAPAPVAAPVEQHGQAPEAAPDAHGSPAGEPGAAVEAHAAA AEHGEAAGHEGGHDESLGAVMLHHVTDGYVIEHPGLCHGGLAWNCEWDLRETFGDSLKFG KLDMTPTKHVVMMWLASALLLVVVLGAVRKKSLVPRGLYNFIELLVAFVRNEIAVKNMGE KDADRFTPYLVTAFFFILFLNLFGLLPFSATATANLSVTVAMALFTFVITQYAAIRAMGM GGYLAHLTGGVPKSLAPLWLIMIPVEFLGLFTKPFALTVRLFANMLAGHFVILALLGLIF ALGTPWVAFGSVPMALSIFLLELFVAFVQAYIFTMLSSLFIGAGLVHHGDDHGHAEEHGH AGPAAGSEHGSHVAGASPGHG
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaeromyxobacter dehalogenans and why is its ATP synthase of interest to researchers?

Anaeromyxobacter dehalogenans is a facultative anaerobic myxobacterium that belongs to the Myxococcaceae family but forms a distinct phylogenetic branch with approximately 9.0% difference in 16S rDNA sequence from other myxobacterial genera . It was first isolated from various soils and sediments based on its chlororespiring capabilities.

The ATP synthase of A. dehalogenans is of particular interest because:

  • It represents an evolutionary intermediate between the well-studied bacterial F-type and archaeal A/V-type ATP synthases

  • The organism can thrive in anaerobic conditions where energy conservation is particularly challenging

  • It may provide insights into energy metabolism in environments with low thermodynamic driving forces

A. dehalogenans can use multiple electron acceptors including 2-chlorophenol, 2,6-dichlorophenol, 2-bromophenol, nitrate, fumarate, and oxygen, with optimal growth occurring at low concentrations (<1 mM) of electron acceptor . This metabolic versatility makes its energy conservation mechanisms, including ATP synthase function, particularly interesting to study.

How does the ATP synthase subunit a (atpB) function within the ATP synthase complex?

ATP synthase subunit a (atpB) is a critical component of the membrane-embedded Fo sector of ATP synthase. This subunit functions in three primary ways:

  • It forms part of the proton channel that allows H+ ions to flow down their electrochemical gradient

  • It interacts with the rotating c-ring during ATP synthesis

  • It provides a static counterpart to the rotating components, allowing mechanical energy to be converted to chemical energy

In ATP synthase, protons move through a channel formed between subunit a and the c-ring, causing the c-ring to rotate. This rotation is mechanically coupled to the F1 sector, where ATP synthesis occurs through conformational changes in the catalytic sites .

The a subunit contains essential proton-conducting residues that form part of the pathway for proton translocation. Recent research suggests that subunit a provides a physical link between the proton channel and the peripheral stalk of ATP synthase .

What expression systems are most effective for producing recombinant A. dehalogenans ATP synthase subunit a?

Based on available research, E. coli has been the most reliable heterologous expression system for recombinant A. dehalogenans ATP synthase subunit a. The protein has been successfully expressed as a His-tagged fusion protein in E. coli .

When expressing membrane proteins like atpB, several considerations are critical:

  • Expression strain selection: BL21(DE3) or C41(DE3)/C43(DE3) strains are often preferred for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) typically yield better results

  • Membrane extraction: Careful membrane isolation followed by solubilization with appropriate detergents (DDM, LDAO, or Triton X-100) is essential

The full-length atpB protein (384 amino acids) has been successfully expressed with an N-terminal His tag, allowing for purification by affinity chromatography .

What are the optimal storage and handling conditions for purified recombinant atpB protein?

The optimal storage and handling conditions for purified recombinant atpB protein are:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C/-80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been shown to maintain stability

  • Reconstitution: Prior to use, centrifuge vials briefly to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Cryoprotection: Addition of 5-50% glycerol (typically 50% final concentration) is recommended before freezing

It's critical to avoid repeated freeze-thaw cycles as they can significantly reduce protein activity. The shelf life of the liquid form is approximately 6 months at -20°C/-80°C, while the lyophilized form can be stable for up to 12 months .

How does the structure of A. dehalogenans ATP synthase subunit a compare to other bacterial and archaeal homologs?

The ATP synthase of A. dehalogenans possesses an F-type ATP synthase, which differs from the A/V-type ATP synthases found in many archaea and some bacteria. Comparative analysis reveals:

  • Membrane-spanning regions: The atpB protein contains multiple transmembrane helices that form the proton channel

  • Conserved residues: Essential arginine residues involved in proton translocation are conserved across species

  • Phylogenetic placement: Evolutionary analysis places A. dehalogenans ATP synthase as part of the bacterial F-type ATP synthase lineage despite its unusual ecological niche

Recent phylogenetic studies have shown that the divergence of ATP synthase into F- and A/V-type lineages was a very early event in cellular evolution dating back to more than 4 billion years ago, potentially predating the diversification of Archaea and Bacteria .

The sequence of A. dehalogenans ATP synthase subunit a contains 384 amino acids with multiple transmembrane segments. While it shares the fundamental structure of bacterial F-type ATP synthases, its adaptation to the organism's unique physiology may result in distinctive structural features still being investigated.

What role does ATP synthase play in the energy metabolism of A. dehalogenans under anaerobic conditions?

ATP synthase plays a crucial role in energy conservation in A. dehalogenans under anaerobic conditions through several mechanisms:

  • Coupling to respiratory chains: A. dehalogenans can use various electron acceptors including chlorinated compounds, nitrate, and fumarate, which generate proton motive force to drive ATP synthesis

  • Low driving force adaptation: Studies on anaerobic ATP synthases suggest they can function at lower proton motive force thresholds

  • Alternative ion coupling: Some anaerobic ATP synthases can use Na+ instead of H+ as coupling ions

Research on ATP synthases from anaerobic archaea has shown that they can synthesize ATP at surprisingly low driving forces of 90-150 mV . This may also apply to A. dehalogenans, allowing it to thrive in energy-limited anaerobic environments.

The ATP synthase of A. dehalogenans likely operates in concordance with its versatile respiratory capabilities. When growing by chlororespiration or nitrate reduction, electron transport generates a proton gradient that drives ATP synthesis. Under conditions with limited electron acceptors, the ATP synthase must function efficiently to maximize energy conservation.

What assays can be used to measure the activity of recombinant ATP synthase subunit a in vitro?

Since the a subunit is one component of the ATP synthase complex, functional assays typically require reconstitution with other subunits or measurement of specific interactions:

  • Proteoliposome reconstitution:

    • Incorporating purified ATP synthase containing atpB into liposomes

    • Generating artificial ion gradients (e.g., K+ diffusion potential with valinomycin)

    • Measuring ATP synthesis rates in response to the gradient

  • Proton translocation assays:

    • Using pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Monitoring pH changes in proteoliposomes containing reconstituted ATP synthase

  • Protein-protein interaction studies:

    • Crosslinking assays to identify interactions between subunit a and other components

    • Pull-down assays using the His-tagged recombinant protein

Based on studies with other ATP synthases, a typical ATP synthesis assay would involve:

  • Reconstitution of ATP synthase into liposomes

  • Creation of a membrane potential (Δψ) of approximately 160 mV using K+/valinomycin

  • Addition of ADP and Pi

  • Measurement of ATP production over time using the luciferin/luciferase assay

Research with other ATP synthases has demonstrated ATP synthesis rates of approximately 99.2 nmol·min⁻¹·mg protein⁻¹ under optimal conditions .

How can researchers determine the threshold driving force required for ATP synthesis by A. dehalogenans ATP synthase?

Determining the threshold driving force requires careful bioenergetic measurements:

  • Controlled proteoliposome experiments:

    • Prepare proteoliposomes containing purified ATP synthase

    • Establish defined proton motive force (PMF) values by controlling both ΔpH and Δψ components

    • Measure ATP synthesis at various PMF values to determine the threshold

  • Calculation of energetic parameters:

    • Apply the thermodynamic relationship: ΔGp = n·ΔμH+, where:

      • ΔGp is the phosphorylation potential

      • n is the number of protons translocated per ATP

      • ΔμH+ is the proton motive force

  • Comparative analysis:

    • Compare threshold values with those of other organisms to assess adaptations

A research protocol to determine threshold driving force typically involves:

  • Establishing a series of defined ion gradients by varying K+ concentrations

  • Adding valinomycin to generate specific membrane potentials

  • Measuring ATP synthesis at each potential value

  • Plotting ATP synthesis rate versus driving force to identify the threshold

Studies with other bacterial ATP synthases have found threshold values ranging from 87 mV for ATP synthases from anaerobic organisms to 150 mV for E. coli . The threshold for A. dehalogenans ATP synthase would provide valuable insights into its energetic adaptations.

What techniques are most appropriate for determining the structure of A. dehalogenans ATP synthase subunit a?

Several complementary techniques can be employed to determine the structure of ATP synthase subunit a:

  • Cryo-electron microscopy (cryo-EM):

    • Most suitable for membrane proteins and large complexes

    • Can resolve structures to near-atomic resolution

    • Requires purification of the entire ATP synthase complex

  • X-ray crystallography:

    • Challenging for membrane proteins but potentially provides high-resolution structures

    • Requires successful crystallization, which is difficult for membrane proteins

    • May be applied to soluble fragments or specially engineered constructs

  • NMR spectroscopy:

    • Useful for specific domains or segments of the protein

    • Can provide dynamic information not available from static structures

    • Limited by protein size, so typically applied to fragments rather than the whole protein

  • Computational modeling:

    • Homology modeling based on known structures of related proteins

    • Molecular dynamics simulations to understand conformational flexibility

    • Integration with experimental data from crosslinking or mutagenesis studies

How can recombinant A. dehalogenans ATP synthase subunit a be used to investigate the evolutionary relationship between F-type and A/V-type ATP synthases?

Recombinant A. dehalogenans ATP synthase subunit a provides a valuable tool for evolutionary studies:

  • Phylogenetic analysis:

    • Sequence comparisons with both F-type and A/V-type ATP synthases

    • Identification of conserved motifs and lineage-specific adaptations

    • Construction of phylogenetic trees to establish evolutionary relationships

  • Chimeric protein construction:

    • Creating fusion proteins containing segments from both F-type and A/V-type synthases

    • Testing functionality of hybrid constructs

    • Identifying which regions determine type-specific properties

  • Functional complementation studies:

    • Expressing A. dehalogenans atpB in mutants of other organisms lacking functional a subunit

    • Assessing the degree of functional rescue

    • Determining compatibility between components of different ATP synthase types

Recent evolutionary studies suggest that the divergence of ATP synthase into F- and A/V-type lineages occurred very early in cellular evolution, dating back more than 4 billion years ago . Investigating the properties of A. dehalogenans ATP synthase could provide insights into this ancient divergence and the adaptations that occurred in different lineages.

The fact that A. dehalogenans thrives in environments with potentially low driving forces for ATP synthesis makes its ATP synthase particularly interesting for understanding how these molecular machines adapted to different bioenergetic constraints throughout evolution.

How does A. dehalogenans ATP synthase activity correlate with the organism's ability to utilize different electron acceptors?

A. dehalogenans is remarkably versatile in its use of electron acceptors, and ATP synthase activity is likely optimized for each metabolic mode:

  • Chlororespiration:

    • When using chlorinated compounds like 2-chlorophenol, A. dehalogenans generates a proton motive force

    • ATP synthase must be efficient at harnessing this force for ATP production

    • The energy yield from chlororespiration may be lower than from other respiratory pathways

  • Nitrate reduction:

    • A. dehalogenans reduces nitrate to ammonium

    • This pathway generates a proton gradient that drives ATP synthesis

    • The relative energy yield affects ATP synthase operation

  • Oxygen utilization:

    • Although primarily anaerobic, A. dehalogenans can grow under microaerobic conditions

    • Oxygen utilization potentially provides higher energy yields

    • ATP synthase must adapt to varying proton motive force magnitudes

  • Fumarate reduction:

    • Under anaerobic conditions with fumarate as electron acceptor

    • Likely generates intermediate levels of proton motive force

The relationship between electron acceptor utilization and ATP synthesis can be illustrated by the following table:

Electron AcceptorEstimated PMF (mV)ATP Synthesis EfficiencyGrowth Rate
O₂ (low levels)150-200HighestModerate
Nitrate120-150HighGood
Fumarate100-130ModerateGood
2-Chlorophenol90-120LowerSlower

Research suggests that A. dehalogenans exhibits a preference hierarchy for electron acceptors, with 2-chlorophenol being reduced in preference to nitrate . This preference likely reflects optimal energy conservation strategies involving ATP synthase under different growth conditions.

What insights can studies of A. dehalogenans ATP synthase provide for understanding ATP synthesis at low driving forces?

Studies of A. dehalogenans ATP synthase could provide significant insights into ATP synthesis at low driving forces:

  • Threshold determination:

    • Determining the minimum proton motive force required for ATP synthesis

    • Comparing with ATP synthases from other organisms adapted to different energy regimes

  • Structural adaptations:

    • Identifying unique features that allow function at low driving forces

    • Understanding how the c-ring stoichiometry might be optimized for low-energy environments

  • Regulatory mechanisms:

    • Investigating how ATP synthase activity is regulated under energy-limited conditions

    • Exploring potential adaptations that prevent ATP hydrolysis when proton motive force is insufficient

Research on archaeal ATP synthases has shown that some can operate at driving forces as low as 87-90 mV, significantly lower than the 120-150 mV typically required by bacterial ATP synthases like those from E. coli . A. dehalogenans may possess similar adaptations given its ability to thrive in energy-limited anaerobic environments.

Understanding these adaptations has broader implications for:

  • Bioenergetics at the thermodynamic limit

  • Evolution of early life in energy-constrained environments

  • Engineering of more efficient bioenergetic systems

What are the critical steps and potential pitfalls in purifying active recombinant A. dehalogenans ATP synthase subunit a?

Purifying active recombinant ATP synthase subunit a presents several challenges due to its hydrophobic nature and membrane localization:

  • Expression optimization:

    • Critical step: Induction conditions must be carefully optimized

    • Potential pitfall: Overexpression often leads to inclusion body formation

    • Solution: Use lower temperatures (16-20°C) and reduced inducer concentrations

  • Membrane extraction:

    • Critical step: Gentle lysis to preserve native protein conformation

    • Potential pitfall: Harsh detergents can denature the protein

    • Solution: Use milder detergents like DDM or LDAO at their critical micelle concentrations

  • Affinity purification:

    • Critical step: Imidazole concentration gradient for His-tagged protein elution

    • Potential pitfall: Non-specific binding of other proteins

    • Solution: Include low imidazole (10-20 mM) in binding buffer

  • Detergent exchange:

    • Critical step: Transition to detergents suitable for functional studies

    • Potential pitfall: Protein aggregation during detergent exchange

    • Solution: Gradual exchange using size exclusion chromatography

  • Quality assessment:

    • Critical step: Verification of proper folding and oligomeric state

    • Potential pitfall: Purified protein may be misfolded or aggregated

    • Solution: Circular dichroism and size exclusion chromatography analysis

A successful purification protocol should yield protein with >85% purity as determined by SDS-PAGE , with proper secondary structure content as verified by circular dichroism spectroscopy.

How can researchers effectively reconstitute recombinant ATP synthase components into functional complexes for in vitro studies?

Effective reconstitution of ATP synthase components requires careful attention to several key factors:

  • Component preparation:

    • Purify individual subunits under conditions that maintain native structure

    • Verify proper folding of each component prior to reconstitution

    • Ensure appropriate detergent solubilization of membrane components

  • Assembly procedure:

    • Step-wise approach: Follow the natural assembly pathway

      1. Form the c-ring

      2. Add F1 sector

      3. Incorporate peripheral stalk components

      4. Finally add subunits a and other Fo components

    • Direct reconstitution: Mix purified F1 and Fo sectors in appropriate detergents

  • Liposome preparation:

    • Use lipid compositions that mimic native membranes (e.g., E. coli polar lipids)

    • Create uniform unilamellar vesicles (typically 100-200 nm diameter)

    • Control internal buffer composition for ion gradient establishment

  • Protein incorporation:

    • Detergent-mediated reconstitution with controlled protein:lipid ratios

    • Detergent removal via biobeads, dialysis, or gel filtration

    • Verification of incorporation orientation (typically random)

  • Functional verification:

    • ATP synthesis assays with artificial ion gradients

    • ATP hydrolysis measurements

    • Proton pumping assays using pH-sensitive dyes

Based on studies with other ATP synthases, successful reconstitution typically results in proteoliposomes containing 5-10 μg protein per mg of lipid, with approximately 70-80% of complexes correctly oriented for ATP synthesis assays (F1 facing outward) .

The assembly of ATP synthase components has been shown to involve distinct modules: the c-ring, F1, and the subunit a/A6L complex that converge in the final assembly stages . This knowledge can guide reconstitution strategies for A. dehalogenans ATP synthase.

What is the stoichiometry of protons transported per ATP synthesized in A. dehalogenans ATP synthase?

The proton:ATP stoichiometry is a fundamental parameter of ATP synthase function that impacts the threshold driving force required for ATP synthesis:

  • Determinants of stoichiometry:

    • The number of c-subunits in the c-ring is the primary determinant

    • Each c-subunit typically binds one proton during rotation

    • Three ATP molecules are synthesized per complete c-ring rotation

  • Theoretical considerations:

    • According to the thermodynamic relationship: ΔGp = n·ΔμH+

    • Where n is the H+/ATP ratio

    • Lower n values allow ATP synthesis at lower proton motive force values

  • Implications for A. dehalogenans:

    • As an organism that may operate near the thermodynamic limit of ATP synthesis

    • May have evolved a c-ring with fewer subunits to enable ATP synthesis at low driving forces

While the exact stoichiometry for A. dehalogenans ATP synthase has not been experimentally determined, comparative analysis with other organisms provides some insights:

OrganismEnvironmentc-ring SizeH+/ATP RatioMin. PMF for ATP Synthesis
E. coliFacultative anaerobe103.3~150 mV
Thermophilic Bacillus PS3Thermophile103.3>180 mV
Anaerobic archaea (estimated)Extreme anaerobe6-82-2.787-90 mV
A. dehalogenans (predicted)Facultative anaerobe8-102.7-3.3~90-120 mV

Research on ATP synthases from anaerobic organisms suggests that they may operate with smaller c-rings, allowing them to synthesize ATP at lower driving forces . Given A. dehalogenans' ability to grow under various anaerobic conditions, its ATP synthase may have evolved similar adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.